KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_18105Help
Entry
AMBAS45_18105     CDS       T02253                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb03030  DNA replication
amb03410  Base excision repair
amb03420  Nucleotide excision repair
amb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:amb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AMBAS45_18105
   03410 Base excision repair
    AMBAS45_18105
   03420 Nucleotide excision repair
    AMBAS45_18105
   03430 Mismatch repair
    AMBAS45_18105
Enzymes [BR:amb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMBAS45_18105
    6.5.1.6  DNA ligase (ATP or NAD+)
     AMBAS45_18105
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AMBAS45_18105
DNA replication proteins [BR:amb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AMBAS45_18105
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AMBAS45_18105
DNA repair and recombination proteins [BR:amb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AMBAS45_18105
   NER (nucleotide excision repair)
    Other NER factors
     AMBAS45_18105
   MMR (mismatch exicision repair)
    Other MMR factors
     AMBAS45_18105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_A_N Peptidase_M75 NEMO
Motif
Other DBs
NCBI-ProteinID: AFT97078
UniProt: K0EK58
LinkDB All DBs
Position
4256926..4258596
Genome map
AA seq 556 aa AA seqDB search
MEEFSNLLEQLYYTAGTKAKAQLIADYIANTPDPDRGWAIAAMAGTLRFDFFKRNTVKKL
ITEHTDPALFAMSYDYVGEVSETVAHLWPYSEPTDNLPSLTEVVETFASVSKQKVSETLA
NYLTIMTPAQRWALLKLGTRGLRIGVSARSIKQILADYGNKDIKEIETLWHAVTPPYSEM
LAWLEGDADKPNVENAVTFHPVMLSHPIEDSDIDAFEENTWQIENKYDGIRVQLAVKSER
SVGNKAAKKNTSQSSDDDTPDKALFSRTGDDISHSFPDLLETVKGNMVLDGELLVIHNVK
EDAYDAMASQPNVDTFNALQQRLNKKKPSKALQASAPVGLIVYDALVLDGEDLTEKTLKE
RRHALNEWFNHNKSERLFLSETLSATSPESLRELHAHVCQNRAVEGLMIKRLDSKYIPGR
PKGQWFKWKRDPLVVDAVMMYAQRGHGKRSSFYSDYTFGAWEDDQLLPIGKAYSGFTDEE
LKKLDNWVRRNAVGRFGPVREVKKDLVLEVAFDAVHPSSRHKSGVALRFPRIHRIRWDKP
ATEADTLANVKALIES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattcagtaacctgcttgagcagctttactatacagcgggaactaaagccaaa
gcgcaactcattgccgattacattgccaacacacctgatcctgaccgtggctgggccatt
gctgctatggcagggacattgcgttttgatttttttaaacgcaacacagtaaaaaaactt
attaccgagcacaccgaccctgctctctttgcaatgagctacgattatgtaggcgaagtc
agcgaaaccgtggcgcatttatggccttacagtgaacccacagataatcttccaagtctt
actgaagtcgtagaaacctttgcgtctgtgagtaaacagaaggtgtcggaaacgctagcc
aactacctgacgataatgacccctgcacagcgctgggctttattgaaacttggcacccgc
ggattgcgcataggcgtgtcggctcgttccattaagcaaatactggccgattatggcaat
aaagatatcaaagaaattgagacgctgtggcatgcggttacaccaccttattcagagatg
cttgcttggttagaaggcgacgctgacaaacctaatgttgaaaatgcggttacctttcac
cccgtgatgctttcgcaccctatcgaggacagcgatattgatgcctttgaggaaaacacg
tggcaaattgaaaataagtacgacggcattcgagtacagctcgctgttaaatcagaaagg
tctgtaggtaataaagccgctaaaaaaaatacctctcagtcttcggatgacgatacgcca
gataaagcgcttttctcacgcacaggagatgacattagccattcttttccagacctactt
gaaacggtaaaaggaaatatggtgctagacggtgaactactggttattcataacgtaaag
gaagatgcttatgacgctatggcttcacagccgaatgtcgacacattcaatgcactgcag
caacgcctcaataagaaaaagccgagcaaagcactgcaagcatctgcacctgtcgggctt
attgtttacgatgccctagtgttagatggcgaagatttaactgagaaaacattgaaggaa
cgtcgccacgctctcaacgaatggtttaaccacaataagagcgagcgcttgtttttatcg
gaaaccctttcggcaacctctcctgaaagccttcgtgaacttcacgcccacgtttgtcaa
aatcgcgcggtggaagggttgatgataaagcgcttagatagcaagtacatccccggccgt
cccaaagggcaatggttcaagtggaagcgcgacccgctggtggttgatgcagtaatgatg
tacgcgcagcgagggcacgggaaacgatcgagcttctattccgattacacgttcggcgca
tgggaagacgaccagcttctgccaataggaaaagcatattctggatttaccgacgaagaa
cttaagaagctagacaactgggtacggcgcaatgcagtgggacgctttggccctgtgcgg
gaggtaaagaaagatctggtgttagaagtggctttcgacgctgtacacccatcctccaga
cataagtcaggtgttgcattgcgctttccccgtattcaccgtattcgctgggacaagccc
gcaactgaggctgacacactagccaacgttaaagctttaatagaaagttaa

DBGET integrated database retrieval system