KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_18515Help
Entry
AMBAS45_18515     CDS       T02253                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:amb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AMBAS45_18515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amb02000]
    AMBAS45_18515
Transporters [BR:amb02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AMBAS45_18515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_23 AAA_29 NACHT RsgA_GTPase Rad17 AAA_25 NTPase_1 RNA_helicase AAA AAA_22 AAA_5 T2SSE
Motif
Other DBs
NCBI-ProteinID: AFT97160
UniProt: K0EP51
LinkDB All DBs
Position
complement(4357178..4358767)
Genome map
AA seq 529 aa AA seqDB search
MKSKPAYLTLLLALLHGVAGITILVISSWFIAISAIAPVGFNYVIPAVVIRALALLRIAS
GYASMWVGHNDLLTRIAEGRLLVFSQLENSKITDKAFTTEALAQHTETLASRWIAWIAPL
SNITFIFTNLCVAAVWFDLPGTSFLLTLFVIWLFIVVLQGFSGLNVAKKATKENKVFRQE
SADFLNCSALWHLNKTMTDKPQEEGGHVINSVPSADRVWRQQTAQKDKAQRASWWFQGAA
FFAVVLVMSGAVSPISDFSYMPIAIVVPMILMAAPDWAGAAFHSISKFAQHKQSVKALKK
LKTTPIQVIENTELHHSLTLSDYTAKNRRLPLVNATFPATGIVCISGPSGCGKSSLLQSI
AGVVPSTGLKEVDGMRIPDGLIKNWRYVEQEPIVLSGSVSSNLDPAGMGIPLDDMTNLLA
QLALEALLPLSMWVGKAGRALSGGERKRLALARAILSHAKVLLVDEPFEGLDVTTQHKVC
EVLNRYAANHLILVASHVTPSALNVSSTLSLDEGSVGNLSKGQRLNMVT
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaaaccggcttatctcacgctactgcttgctcttttacacggtgtggcagga
ataaccattctcgttatttcttcgtggtttattgctatcagtgctattgcacctgtaggt
tttaactacgttattccggcggtggttattcgcgcgctagcactacttcgcattgcttcg
ggatatgccagtatgtgggtgggtcataacgatttgcttacccgtatcgcagaggggcgc
ttgcttgtattcagtcaacttgaaaacagtaaaattaccgacaaagcattcacaacagaa
gcattagcccagcataccgaaacgcttgccagtcggtggattgcttggatagctccgctt
tctaacatcacatttatattcactaacctttgcgttgctgcggtatggtttgaccttccc
ggcacctcgtttttacttacactttttgttatttggctcttcatcgttgtgctgcaaggc
tttagtggtttaaacgttgcgaaaaaagcgacaaaggaaaataaagtgtttcgccaagag
tcagccgactttctcaactgcagcgctttatggcacttaaataaaacaatgacagataag
ccacaggaagagggtgggcatgtgatcaatagtgtgccgagtgctgacagggtgtggcga
caacaaactgcgcagaaagacaaagcgcaacgcgcgagctggtggtttcaaggcgcggca
ttttttgcggtagtgttagttatgtcgggcgcagtaagtccaatatctgacttttcgtat
atgcctattgctattgttgtgcccatgatattgatggctgcgcctgattgggctggtgcg
gcttttcacagcatatccaagtttgcacagcacaaacaaagtgtgaaggcccttaaaaag
ctcaagaccacacccattcaggtaatcgaaaataccgaactgcaccattcactcacgtta
tctgattatactgccaaaaatagacgcttacctttggtcaatgctacattcccagccact
ggcatcgtatgtatatccgggccgtcaggctgtggtaagtcatctttgcttcagtcaatt
gcgggggttgtgccttctactggacttaaagaagtggatggcatgcgtatacccgatggc
ttaattaaaaactggcgctatgtggaacaagagccaatagtgctttctggcagtgtctct
tcaaatttagaccctgccggaatgggtattccccttgatgacatgactaacctgttggct
caattagcgctagaggcactgttgccgttgtctatgtgggttggcaaggcgggaagggcg
ctttctgggggagagcgtaagcgactagccttagcgcgcgctattttatctcacgcaaaa
gtgttgcttgttgatgaacccttcgagggcttggatgtgactactcagcataaagtgtgt
gaggtattaaatcgctacgctgccaaccatctcatccttgttgcttctcacgttacgcca
agcgcgttaaatgtatcatcaacactatcactagatgaagggagtgttggtaacctgagt
aaaggtcagcgcctcaacatggtcacttga

DBGET integrated database retrieval system