KEGG   Alteromonas mediterranea DE: MADE_1002565Help
Entry
MADE_1002565      CDS       T00747                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01130  Biosynthesis of antibiotics
amc01230  Biosynthesis of amino acids
Module
amc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:amc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MADE_1002565 (aroK)
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MADE_1002565 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 Cytidylate_kin AAA_33 AAA_16 AAA_24 AAA_25 dNK ABC_tran AAA_22 AAA APS_kinase TsaE Ploopntkinase3 Guanylate_kin AAA_29 RNA_helicase AAA_5 AAA_7 AAA_28 AAA_17 RsgA_GTPase AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: AEA96662
UniProt: B4S0F6
LinkDB All DBs
Position
complement(540758..541273)
Genome map
AA seq 171 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLADELHLDFFDSDQEIERRTGADIAWIFDLEGEDGFR
AREENVINDLTDKQGIVLATGGGSIVTKAVRNRLSARGIVVYLQTTIDKQVARTQRDKRR
PLLQNEDPEQVLRDLAEMRNPLYEEVADYIVDTDDQSARAVANQIISKIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacgtaatatctttttagttggcccaatgggtgctggcaaaagtaccatc
ggtagacatctggcagacgaacttcacctagacttttttgattctgatcaggaaattgag
cgccgtacaggtgctgatatcgcttggatctttgatcttgaaggcgaagacggtttccga
gcgcgcgaagaaaatgtcattaatgatttgacagataagcaaggtatcgtgcttgccaca
ggcggcggctctatagtcactaaagctgtgcgtaatcgtttatctgcccgtggtattgtt
gtttacctacaaacaacaatcgacaagcaagttgcccgtacacaacgcgacaaacgtcgc
cctttgctgcaaaacgaagatccagaacaagtacttcgcgatcttgcagaaatgcgcaac
ccgctttacgaagaagttgctgattacattgttgatacagacgaccaaagtgcgcgtgct
gtagcaaatcaaattatcagtaagatcggtctataa

DBGET integrated database retrieval system