KEGG   Alteromonas mediterranea DE: MADE_1007295Help
Entry
MADE_1007295      CDS       T00747                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01130  Biosynthesis of antibiotics
amc01230  Biosynthesis of amino acids
amc02024  Quorum sensing
Module
amc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:amc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MADE_1007295
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MADE_1007295
Enzymes [BR:amc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     MADE_1007295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AEA97601
UniProt: F2G6R4
LinkDB All DBs
Position
1510884..1512227
Genome map
AA seq 447 aa AA seqDB search
MSNWQVDSWRNKPILQQPEYEDKVRLKEVEQTLSSYPPLVFAAEARELRRQLGEVSLGKG
FLLQGGDCAESFDEFNAPKIRDTFKVILQMAIVLTFAGRCPVTKVARMAGQYAKPRSSDF
ETRGGVKLPSYRGDIINNFEFTEAARRPDPERLLEAYHRSASTLNLLRAFAQGGLADLHE
VNRWNMAFVENNPLKDRYSDMANRIQDTLEFMDVIGINAQTSSTLHETSLFTSHEALLLN
YEQALTRVDTLTGKPYDCSAHMVWIGERTRQLDHAHVEFFRGIHNPIGVKVGPSMQEDEL
IRLIDALNPLNDPGRLTLITRMGADNLADNLPRLLRKVKAERRHVVWSSDPMHGNTFSAS
SGYKTRNFDSILREIKQFFQAHEAEGTHAGGIHLEMTGQHVTECTGGAYQISDDDLAQAY
KTQCDPRLNADQVLEMAFLVADHLRNA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaattggcaagtagacagttggagaaataaacctattcttcaacaaccagagtac
gaagacaaagtacgtttaaaagaagtagagcaaacactcagttcatatcctccgctggta
ttcgctgccgaagcccgtgagcttagacgtcagcttggtgaagtcagcttaggtaaaggg
tttcttttgcaaggcggtgattgcgccgagtcgtttgacgagtttaacgcaccaaaaatt
cgcgataccttcaaagtaattctgcaaatggcgattgtgcttacgtttgcaggccgctgt
ccggttactaaagttgcgcgtatggcgggtcaatatgccaaacctcgctcatcggatttt
gaaacccgtggtggtgttaagttgccaagctaccggggcgatatcattaataattttgag
ttcaccgaagcggctcgccgtccagaccccgagcgtttgttagaagcgtaccaccgcagc
gcatctaccttgaacttgctgcgtgcgtttgcgcagggcggtttggcagaccttcacgaa
gtgaatcgctggaacatggcgtttgtagaaaacaatccgcttaaagatcgctattcagat
atggctaaccgcattcaagatacccttgagtttatggatgtgattggcattaatgcgcag
acaagctcgacgctacatgaaacatcgctatttacatcgcatgaagctttgctgcttaac
tacgagcaagcgttaacgcgtgtagacacgctaacgggtaagccttacgactgctcggct
cacatggtgtggattggtgaacgtacccgtcaactagaccatgcacacgttgaatttttc
cgtgggatccataaccctattggcgtgaaagtgggtcctagcatgcaagaagacgaactg
attcgtttgattgatgcgctaaacccattaaacgacccaggtcgcttaacgcttatcacg
cgtatgggggctgataacttggcagacaacctgccgcgcttattgcgcaaagtgaaagcg
gaaagacgccatgttgtatggagctctgatccaatgcacggtaataccttctcggcttct
agcggctataaaacgcgtaacttcgattcgattctgcgcgaaataaaacagttcttccaa
gctcatgaagcggaaggcacgcatgccggtggtattcaccttgaaatgaccggtcaacac
gttacagaatgtaccggtggcgcatatcaaatcagtgacgacgatttagcgcaagcgtac
aaaacacaatgtgacccgcgcttaaatgccgatcaggtgcttgaaatggcattcttggtt
gctgatcatttgcgcaacgcatag

DBGET integrated database retrieval system