KEGG   Alteromonas mediterranea DE: MADE_1009000Help
Entry
MADE_1009000      CDS       T00747                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amc  Alteromonas mediterranea DE
Brite
KEGG Orthology (KO) [BR:amc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MADE_1009000
Enzymes [BR:amc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MADE_1009000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like GIDA DAO FAD_oxidored Lycopene_cycl Thi4 AlaDh_PNT_C Thioredoxin_9 NAD_binding_8 Glutaredoxin ABC_transp_aux Thioredoxin_4 K_oxygenase 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEA97938
UniProt: F2GB32
LinkDB All DBs
Position
1965788..1967377
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKSYAETMQKNVTFVVQTGEHSKRDELVKFLSDIASVSEKLNVEERDTNGE
LRSAISFLLEADGEDTGIRFSGIPGGHEFNSLVLAMLHAAGTELKLDDSVKAMVKAINEP
LNFEVFISLSCHNCPEVVQALNQFALVNPNIKAEMIDGGLYQNLIQERDIQGVPSVYLNG
ELFANGKVDASVLINKLIERDPSLKEANKGDALPLQDVTVIGGGPAGVASAIYSARKGLK
VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYDITLKEHVRVDSIEKGN
IKTITLSSGEQIRTRTVIVATGARWRELGVPGERENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADQVLIDQAEKRDNITIIKNAATRQITAEN
GKVNAIEYQDRSTNEIHTRELAGVFVQIGLVPNSQFMKDTVEMTQYGEIVVDNKCHTSEP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESEDESEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcattgaagtcttatgctgaaacaatgcaaaaaaac
gtaacctttgtcgtacagaccggtgaacatagcaagcgcgacgagcttgtgaagtttctg
tccgacattgcatcagtaagcgaaaaacttaatgttgaagagcgcgacactaatggtgaa
ctccgcagcgctatcagcttcctattagaagctgacggtgaagatacgggtatccgtttc
tcaggcattcccggtggtcacgaattcaactctttagtccttgccatgctgcacgcagca
ggcacagaactgaagctagatgacagcgttaaagcgatggtaaaagctatcaatgaaccg
cttaacttcgaagtgttcattagccttagctgtcacaactgcccagaggtcgttcaggcg
ttaaaccaatttgcattggttaatccaaatattaaagctgaaatgattgatggcggttta
tatcaaaacttaattcaagagcgcgacattcaaggtgtaccaagtgtgtatctaaatggc
gagctattcgcaaacggtaaagttgacgcttctgtgcttatcaacaaacttatcgaacgc
gacccaagccttaaagaagcgaataaaggcgacgcgttaccgctgcaagatgtgacggta
attggcggtggcccagctggcgtagcatcagctatctacagcgctcgtaaaggtttgaaa
gtagcaattgttgcagaaacatttggcgggcaggttaaagatacgatgggcattgaaaac
ctaatctctgtgcctaaaaccacaggccctgaacttgttggcaacttgatggagcacgta
cgtgactacgacattacacttaaagagcatgttcgtgtagatagcatcgaaaaaggcaac
atcaaaacgattacgttgtcttctggcgagcaaatccgtacgcgtacggtaattgtcgct
actggtgcccgttggagagagctgggcgtaccaggtgaaagagaaaacgtagggaatggc
gtagcatattgcccacactgtgacggcccattctttaaaggcaaagacgtggcggtaatt
ggtggtggtaactcgggtattgaggctgcactagacctagcaggtatagtgaaatcggta
acggtatttgaattcatgccagagcttaaagccgatcaggtattaatagaccaagctgaa
aagcgcgacaatatcactattattaaaaatgcagcgacccgtcagatcactgcagaaaat
ggcaaagtgaatgcgattgagtaccaagaccgtagtactaacgagattcatacccgcgaa
ctagcaggtgtatttgttcaaattggtcttgttccaaacagccagttcatgaaagatacg
gttgaaatgacacaatacggcgagattgtggtagacaacaagtgtcatacatctgagcct
ggtatatttgcagcgggcgatgtaacaactgttccgtataagcaaattgttatttcaatg
ggcgagggcgctaaagcctcattggcagcgttcgagtatttactaagccacgaagtcgtt
gaatcagaagatgaaagcgaagcagcttaa

DBGET integrated database retrieval system