KEGG   Amycolatopsis mediterranei U32: AMED_0736Help
Entry
AMED_0736         CDS       T01269                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00520  Amino sugar and nucleotide sugar metabolism
amd01100  Metabolic pathways
amd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_0736 (glmS)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_0736 (glmS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amd01002]
    AMED_0736 (glmS)
Enzymes [BR:amd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     AMED_0736 (glmS)
Peptidases and inhibitors [BR:amd01002]
 Cysteine peptidases
  Family C44
   AMED_0736 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 SIS_2 GATase_4
Motif
Other DBs
NCBI-GeneID: 9434954
NCBI-ProteinID: YP_003762958
UniProt: A0A0H3CZ44
LinkDB All DBs
Position
792969..794819
Genome map
AA seq 616 aa AA seqDB search
MGYVGHRPALDVVLGGLRRMEYRGYDSAGVAVLDGAGALTVERKAGRLANLEGRLDEVGR
EHFGGTAGMGHTRWATHGAPVDRNSHPHRDASQRVAVVHNGIIENFAALRTELEADGVEM
ASDTDTETAAHLVARAYTEGDTKGDLTASVAAVCRRLEGAFTLVVTHADHPDTIVAARRS
SPLVVGVGEGEHFVASDVAAFIEHTREAVELGQDQLVVITREGYEVLDFHGDAAQAKPFT
VDWDLSAAEKGGHEYFMLKEIEEQPEALANTLRGHFESGRIILDEQRISDQDLRDVDKVF
VVACGSAYHSGLVAKYAIEHWTRLPVEVELASEFRYRDPVLDRDTLVVAVSQSGETADTL
EAVRHAREQKARVLAVCNTNGAQIPRESDAVLYTHAGPEIGVASTKAFLAQIAANYLVGL
ALAQARGTKYPDEVAREYAELEAMPAAVQKVLSTVEQVRDLGRRIADSKAILFLGRHVGF
PVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDGLPVVVVMPSPKGRAVLHSKLVSN
ISEIQARGARTIVIAEEGDETVRPFADELIEVPAVPTLLQPLVSTVPLQVLAAEIARARG
YDVDKPRNLAKSVTVE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtgggatatgtcgggcaccgcccggctctggacgtcgtcctcggcgggctccggcgcatg
gagtaccgcggttacgactccgccggtgtcgcggtcctcgacggcgccggtgcgctgacc
gtcgagcgcaaggcgggccggctggccaacctggaaggccggctcgacgaggtcggccgc
gagcacttcggcggcaccgccggcatggggcacacccgctgggccacccacggcgcgccc
gtcgaccgcaactcgcacccgcaccgcgacgcctcgcagcgcgttgccgtcgtgcacaac
ggcatcatcgaaaacttcgccgccctccgcaccgagctcgaagccgacggcgtcgagatg
gccagcgacaccgacaccgagaccgccgcccacctggtggcccgcgcgtacaccgaaggc
gacaccaagggcgacctcaccgccagcgtcgccgccgtctgccgccgcctcgaaggcgcg
ttcaccctggtcgtgacgcacgccgaccacccggacacgatcgtggccgcccgccggtct
tcgccgctggtcgtcggggtcggcgagggggagcacttcgtcgcctccgacgtcgccgcc
ttcatcgagcacacccgcgaggccgtcgagctcggccaggaccagctcgtcgtcatcacc
cgcgagggctacgaagtcctggacttccacggcgacgccgcccaggccaagccgttcacc
gtcgactgggacctctccgccgccgagaagggcggccacgagtacttcatgctcaaggag
atcgaggagcagcccgaggcgctggccaacacgctgcgcgggcacttcgagtccggccgg
atcatcctcgacgagcagcgcatctcggaccaggacctgcgtgacgtcgacaaggtcttc
gtcgtcgcctgcggctcggcctaccactccggcctggtcgccaagtacgccatcgagcac
tggacgcggctgccggtcgaggtcgagctggcctcggaattccgctaccgcgacccggtg
ctggaccgcgacacgctggtcgtcgccgtgtcccagtccggcgagacggcggacacgctc
gaagccgtccggcacgcgcgcgagcagaaggcacgcgtcctggccgtctgcaacaccaac
ggcgcgcagatcccgcgcgagtccgacgctgtcctctacacgcacgccgggcctgagatc
ggcgttgcctcgaccaaggcgttcctcgcccagatcgcggccaactacctggtcggcctg
gcgctggcgcaggcccgcggcacgaagtacccggacgaggtcgcgcgcgagtacgccgag
ctggaggccatgcccgcggccgtccagaaggtactgtccactgtggagcaggtgcgcgat
ctcggccgccggatcgccgactcgaaggcgatcctgttcctcggcaggcacgtcggcttc
ccggtcgctctggaaggcgcgctgaagctcaaggagctcgcgtacatgcacgccgaaggc
ttcgccgccggcgagctcaagcacggcccgatcgcgctgatcgaagacggcctgccggtc
gtcgtcgtgatgccctcgcccaagggccgcgcggtgctgcactcgaagctcgtgtcgaac
atcagcgagatccaggcgcgcggcgcccgcaccatcgtcatcgccgaagagggcgacgag
acggtccggccgttcgccgacgagctcatcgaggtcccggcggtgccgacgctgctgcag
ccgctggtgtccaccgtgccgctgcaggtgctggccgcggagatcgcccgcgcccgcggg
tacgacgtcgacaagccgcgtaacctggcgaagtccgtcaccgtggagtaa

KEGG   Amycolatopsis mediterranei U32: AMED_7433Help
Entry
AMED_7433         CDS       T01269                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00520  Amino sugar and nucleotide sugar metabolism
amd01100  Metabolic pathways
amd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_7433 (glmS)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_7433 (glmS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amd01002]
    AMED_7433 (glmS)
Enzymes [BR:amd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     AMED_7433 (glmS)
Peptidases and inhibitors [BR:amd01002]
 Cysteine peptidases
  Family C44
   AMED_7433 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 Corona_S2
Motif
Other DBs
NCBI-GeneID: 9441581
NCBI-ProteinID: YP_003769549
UniProt: A0A0H3DG23
LinkDB All DBs
Position
8212156..8213979
Genome map
AA seq 607 aa AA seqDB search
MCGIVGYIGGQNAAPILLEGLTRLEYRGYDSAGIAVLGAKGGAQVHRVVGRVRNLTAALP
KRLTGKVGIGHTRWATHGPASEANAHPHTSEDGRISVVHNGIIDNADTLRTQLADAGVTL
ASETDTEVLAHLIARSAAETLEDAVVEAVSRITGTYAIAVADSAHPDRLVIARNGSPLII
GVGEREMFVASDLAALVRHTSQVAHLDDGEFATVFATGYRTFTVDESDTTKPATEIDIDA
EDLDLGGYPHYMAKEIQEQPESVERIIRGRLDDRFGVARLDGLNLTPRELRGFARVKILG
CGSAYYVGQIGATMIEELARIPADAEAASEFRYRNPIIEADTLYIAVSQSGETIDTAFAV
EEIKRKGGRVVGLVNVVGSTIARACEGGVYLHAGPEIAVASTKALTNMAVGFALIALALG
RVRDLSNADGQRIIDAIRALPGQIKSILDFEPEIAEHAKTVAAAKSLFFVGRVRGYPVAR
EGAQKFKEISYRHAEAYQTSELKHGPLALIDEALPTVAIVPSDELTGRNLAAVQQIKARG
GAVLAVTHADVDFGELDVPRIVVPKTEPELDPILLTIPLQLLAYHAALTLGYDIDKPRNL
AKSVTVE
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtgggctacatcggcggccagaacgccgcccccatcctgctcgaaggc
ctgacgcggctggagtaccgcggctacgactcggccggcatcgccgtcctcggcgccaag
ggcggcgcccaggtccaccgcgtcgtcggccgggtgcggaacctcaccgccgcgctgccc
aagcggctcaccgggaaggtcggcatcgggcacacgcgctgggccacgcacgggcccgcg
tcggaggccaacgcccacccgcacacgtccgaagacggccggatcagcgtcgtccacaac
ggcatcatcgacaacgccgacaccctacgcacccagctcgccgacgccggcgtcaccctg
gcttccgagaccgacaccgaggtcctcgcccacctgatcgcgcgctcggccgccgaaacc
ctcgaggacgccgtcgtcgaggcggtctcacggatcaccggcacctacgcgatcgccgtc
gccgacagcgcgcaccccgaccgcctggtcatcgcgcgcaacggctcgccgctgatcatc
ggcgtcggcgagcgggagatgttcgtcgccagcgacctcgccgcgctcgtccggcacacc
tcgcaggtcgcgcacctcgacgacggcgagttcgcgaccgtcttcgccaccggctaccgc
accttcaccgtcgacgagagcgacacgaccaagcccgccaccgagatcgacatcgacgcc
gaggacctcgacctgggcggctacccccactacatggccaaggagatccaggaacagccc
gaatccgtcgagcggatcatccgcggccggctcgacgaccggttcggcgtcgcccgcctg
gacgggctgaacctgacgccgcgggagctgcgcggtttcgcccgcgtgaagatcctcggc
tgcggctccgcctactacgtcggccagatcggcgcgacgatgatcgaggagctggcgagg
atcccggccgacgccgaagccgcgtcggagttccgctaccgcaacccgatcatcgaagcc
gacacgctctacatcgcggtcagccagtccggcgagacgatcgacaccgccttcgccgtc
gaggagatcaagcgcaagggcggccgggtcgtcggcctggtcaacgtcgtcggctcgacg
atcgcccgcgcctgcgaaggcggcgtctacctgcacgccggcccggagatcgcggtcgcc
tcgaccaaggcgctgaccaacatggccgtcgggttcgcgctgatcgcactggccctcggc
cgggtgcgcgatctgtccaatgcggacggtcagcggatcatcgacgcgatccgcgcgctg
cccggccagatcaagtccatcctggacttcgagccggagattgccgaacacgcgaagacc
gtcgccgccgcgaagagcctcttcttcgtcggccgggtccgcggctacccggtggcccgg
gagggcgcgcagaagttcaaggagatctcctaccgccacgccgaggcgtaccagacctcc
gagctcaagcacggcccgctcgccctgatcgacgaagcgctcccgacggtcgccatcgtg
ccgtcggacgagctgaccggccgcaacctggccgcggtccagcagatcaaggcccgcggc
ggggcggtcctggcggtgacccacgcggacgtcgacttcggcgaactggacgtcccgcgg
atcgtggtgcccaagaccgagccggagctcgacccgatcctgctgaccatcccgctgcag
ctgctcgcctaccacgccgcgctgaccctgggctacgacatcgacaagccgcgcaaccta
gcgaaatctgtcacagtcgagtag

KEGG   Amycolatopsis mediterranei U32: AMED_8584Help
Entry
AMED_8584         CDS       T01269                                 

Gene name
glmD
Definition
(RefSeq) glucosamine-6-phosphate deaminase
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00520  Amino sugar and nucleotide sugar metabolism
amd01100  Metabolic pathways
amd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_8584 (glmD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_8584 (glmD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amd01002]
    AMED_8584 (glmD)
Enzymes [BR:amd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     AMED_8584 (glmD)
Peptidases and inhibitors [BR:amd01002]
 Cysteine peptidases
  Family C44
   AMED_8584 (glmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2
Motif
Other DBs
NCBI-GeneID: 9442719
NCBI-ProteinID: YP_003770681
UniProt: A0A0H3DKP5
LinkDB All DBs
Position
9422047..9423093
Genome map
AA seq 348 aa AA seqDB search
MMTEQRPGAHMAAEIAQQPDVLAGLVQRQAEIAEVAEKISQRPPRFALLAARGSSDHAAL
YAKYLIEVLLGLPAGLVSPSTATLYGARPDLRDVLFVTVSQSGGSPDLIEVTETARRQGA
LTVSVTNTPDSPLRAASELGVDIGAGVEKAVAATKTYSATLMALYLLIDAVRGGKAADAE
KIGELAQQTLDGAEEGVQRAVDRYRFVDRVLTTGRGYSYASALEGSLKLAETSYLAARAY
SGADLLHGPVAAVDGETAVLAVTSAGHGGRAMHEVLEAVSKRGADVLAVGSAAAEVPAAL
RIDVAPTVEELAPILEILPIQRIALGLSLARGGDPDSPRGLLKVTKTR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgaacaacggcccggcgcgcacatggccgcggagatcgcccagcagccggac
gtcttggcgggactggtgcagcgtcaggcggaaatcgccgaagtggcggaaaagatctca
caacgcccgccgcggttcgcgttgctcgccgcgcgtggatcgagcgaccacgcagcgttg
tacgcgaagtacctgatcgaggtactgctcggccttccggccggtctggtttccccgtcc
acggcgacgctgtacggcgcgcggcccgatctgcgggacgtgctgttcgtcacggtcagc
cagagcggcggctcgcccgacctgatcgaggtcaccgaaacggcgcgccgccagggcgcg
ctgacggtgtccgtcaccaacaccccggactcgccgctgcgggcggcctccgagctcggc
gtcgacatcggcgcgggcgtcgagaaggccgtcgcggccaccaagacgtactccgcgacg
ctgatggcgctgtacctgctgatcgacgcggtgcgcggcggcaaggcggccgacgccgag
aagatcggggagctggcgcagcagaccctcgacggcgccgaggagggcgtgcagcgcgcg
gtcgaccggtaccgcttcgtggaccgggtcctcaccaccggccgcggctactcctacgcc
agcgcgctcgagggttcgctcaagctcgccgagaccagctacctcgccgcccgcgcgtac
agcggcgcggacctgctgcacggcccggtcgcggcggtggacggcgagaccgccgtgctc
gcggtgaccagcgccgggcacggcggccgggcgatgcacgaggtcctcgaagccgtcagc
aagcgcggcgcggacgtcctcgcggtcggttcggccgccgccgaggtgcccgcggcgctg
cgcatcgacgtcgccccgacggtcgaggagctggcgccgatcctggagatcctgccgatc
cagcggatcgcgctcggcctgtcgctcgcccgcggtggcgacccggacagcccgcgcggc
ctgctgaaggtgaccaagacccggtga

DBGET integrated database retrieval system