KEGG   Amycolatopsis mediterranei U32: AMED_0833Help
Entry
AMED_0833         CDS       T01269                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00020  Citrate cycle (TCA cycle)
amd00480  Glutathione metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
amd01210  2-Oxocarboxylic acid metabolism
amd01230  Biosynthesis of amino acids
Module
amd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMED_0833 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMED_0833 (icd)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AMED_0833 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9435051
NCBI-ProteinID: YP_003763055
UniProt: A0A0H3CWG2
LinkDB All DBs
Position
891500..892723
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLDYYDLGIEERDRTDDQVTVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVIQNIPRL
VPTWTKPIIIGRHAHGDQYKATNFKVPGPGKLTISYTPDDGSEPMEFQVAQFPEGGGVAM
GMYNFKKSIEDFARASLQYGLDRGLPVYLSTKNTILKAYDGQFKDVFEEIFQNEFKADFD
AKGISYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLEHRGKLDGNQELIGFANTLE
QVVVETVESGQMTKDLALLISKDQPWQTTEEFLATLDDNLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgtcgtcgaactcgacggcgatgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtgaacctggac
tactacgacctgggtatcgaggagcgggaccgcaccgacgaccaggtcacggtcgactcc
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgccacgatcaccccggacgag
gcccgcgtcgaagagttcggcctcaagaagatgtggctgtccccgaacgggaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatccagaacatcccgcggctg
gtgccgacgtggaccaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gcgaccaacttcaaggtccccggcccgggcaagctgaccatcagctacaccccggacgac
ggctccgagccgatggagttccaggtcgcgcagttccccgagggcggcggcgtcgccatg
gggatgtacaacttcaagaagtcgatcgaggacttcgcgcgcgcgtcgctgcagtacggc
ctcgaccgcggcctgccggtctacctctccaccaagaacaccatcctcaaggcctacgac
ggccagttcaaggacgtgttcgaggagatcttccagaacgagttcaaggccgacttcgac
gccaagggcatctcctacgaacaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtccagtccgacacg
gtcgcgcagggcttcggttcgctcggcctgatgacgtcggtgctgcgcacgccggacggc
cggaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatctacgcctggacccgcggcctc
gagcaccgcggcaagctggacggcaaccaggagctgatcggcttcgcgaacacgctggag
caggtcgtcgtcgagaccgtcgagagcggtcagatgacgaaggacctcgcgctgctcatc
agcaaggaccagccgtggcagacgaccgaggaattcctcgcgacgctggacgacaacctg
gcgaagaagatcgcccagggctga

DBGET integrated database retrieval system