KEGG   Amycolatopsis mediterranei U32: AMED_2306Help
Entry
AMED_2306         CDS       T01269                                 

Gene name
gltB
Definition
(RefSeq) glutamate synthase (NADPH/NADH) large subunit
  KO
K00265  glutamate synthase (NADPH) large chain [EC:1.4.1.13]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00910  Nitrogen metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AMED_2306 (gltB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_2306 (gltB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amd01002]
    AMED_2306 (gltB)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     AMED_2306 (gltB)
Peptidases and inhibitors [BR:amd01002]
 Cysteine peptidases
  Family C44
   AMED_2306 (gltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG FMN_dh
Motif
Other DBs
NCBI-GeneID: 9436513
NCBI-ProteinID: YP_003764505
UniProt: A0A0H3D0G0
LinkDB All DBs
Position
2452940..2457493
Genome map
AA seq 1517 aa AA seqDB search
MIFSAMPGKQGLYDPETEQDSCGVAMVADIRGRRSHGIVTDGLAALMNLDHRGAAGAEPT
SGDGAGILLQLPDVLLRAEAGFALPTPDEHGHHTYAAGIAFLPQDAEQRRKAVGLAERIA
VEEGLEVLGWREVPVDADRADIGPTARSVMPHFAMLFVTGDGKSGVELDRLAFCLRKRVE
NESANAGCGTYFPSLSSRTIVYKGMVTPEQLPAFFADLRDERLESAIALVHSRFSTNTFP
SWPLAHPFRFVAHNGEINTIRGNRNRMRAREALLESDVISGDLSRLFPICSPDASDSASF
DEVLELLHLGGRSLPHAVLMMIPEAWENHATMKPERRAFYQFHASLMEPWDGPACVTFTD
GSLVGAVLDRNGLRPARWWRTADDRVVLASEAGVLDVAPKDVVAKGRLKPGKMFLVDTEA
GRIVDDEEVKSALAAELPYDSWLHAGLLKLAELPDRDHVVQSHDSVLRRQLSFGYTEEEL
KILLAPMAEKGAEPIGSMGTDTPPAVLSKRSRLLYDYFKQNFAQVTNPPLDAIREELVTC
MARIMGPERNLLAPGPASCRHLKLPYPVIDNDELAKLIHINDDGDLPGFACSVLSGLYEV
DGGAEALASAIERVRREASEAIAAGARTLVLSDRDSDHRMAPIPSLLLVAAVHHHLVRTK
ERLRVALVVESGDAREVHHIALLLGYGAAAVNPYLAFETIEDMIGQGAVTGIEPAKAIRN
YVQALVKGVLKIMSKMGISTVGAYTAAQVFESLGLSQNLLDEYFTGTSSKLGGVGLEVLA
EEVATRHRRAYPENPTDRVHRGLDTGGEYAYRREGELHLFTPETVFLLQHASKTGRDEVY
RKYTEEVHRLYREGGTLRGLFAFKDGVREPVPLDEVEPAEAIFKRFNTGAMSYGSISAEA
HETLAIAMNRIGGRSNTGEGGEDPERLYDPERRSAIKQVASGRFGVTSEYLVNADDIQIK
MAQGAKPGEGGQLPPNKVYPWIARTRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNAN
EHARIHVKLVSSLGVGTVAAGVSKAHADVVLISGHDGGTGASPMNSLKHAGTPWEIGLAE
TQQTLLLNGLRDRITVQVDGAMKTGRDVVIAALLGAEEYGFATAPLVVAGCIMMRVCHLD
TCPVGVATQSPELRKRYTGQVEHVVNFFKFVAEEVRETLAALGFRTLDEAIGHAELLNTD
EAVEHWKASGLDLAPIFEMPSETPYGGAKRRTRGQDHGLEHALDRTLIQLAEAALEDAHQ
VNIELPVRNVNRTVGTLLGSEITRRYGGDGLPEGTIHVTLTGSAGQSLGAFLPRGITLDM
VGDANDYVGKGLSGGRIVVRPDPEASFAAEAQTIAGNTIAYGATGGEIFLRGQVGERFCV
RNSGATVVAEGVGDHAFEYMTGGRAVVLGPTGRNLAAGMSGGIAFVLDVDAKKVNQDMVD
LLRPTADDLAWLKKTVQQHYDLTRSAVAASLLGDWPRRSVAFTKVMPRDYQRVLDAAKAA
RAAGRDVDEAIMEAARG
NT seq 4554 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttctccgccatgcccggcaagcagggtctgtacgacccggagaccgagcaggac
tcctgcggtgtggccatggtggccgacatccgcgggcgccgctcccacggcatcgtcacc
gacggcctggccgcgctgatgaacctcgaccaccgcggcgccgcgggcgccgagcccacc
agcggcgacggcgccggcatcctgctgcagctgcccgacgtgctgctgcgggccgaagcc
ggcttcgcgctgcccacaccggacgagcacgggcaccacacctacgccgccggcatcgcg
ttcctgccgcaggacgccgagcagcggcgcaaggccgtcgggctcgccgaacgcatcgcc
gtcgaggagggcctggaggtcctcggctggcgggaggtccccgtcgacgccgatcgcgcc
gacatcggcccgaccgcccgctcggtgatgccgcacttcgccatgcttttcgtcaccggc
gacggaaaatccggtgtggagctggacaggctcgccttctgcctgcgcaagcgcgtcgaa
aacgagagcgcgaacgccggctgcggcacctacttcccgtcgctgtcctcgcggacgatc
gtctacaagggcatggtgacaccggagcagctgccggcgttcttcgccgacctgcgcgac
gagcggctggaaagcgccatcgcgctggtgcactcccgcttctccaccaacaccttcccg
tcgtggccgctggcccacccgttccggttcgtggcccacaacggcgagatcaacaccatc
cgcggcaaccgcaaccgcatgcgggcccgcgaggcgctgctggaatccgacgtcatctcc
ggcgacctttcgcggctgttcccgatctgctcgccggacgcgtcggactcggcgtccttc
gacgaggtcctcgagctgctgcacctgggcggccggtcgctcccgcacgcggtgctgatg
atgatcccggaggcgtgggagaaccacgccaccatgaagcccgagcgccgcgctttctac
cagttccacgccagcctgatggaaccgtgggacggcccggcctgcgtcaccttcaccgac
ggcagcctggtcggcgcggtgctggaccgcaacggcctgcgcccggcgcgctggtggcgc
acggccgacgaccgcgtcgtgctcgccagcgaggccggcgtcctggacgtcgccccgaag
gacgtcgtggccaagggcaggctcaagcccggcaagatgttcctggtcgacaccgaggcc
ggccggatcgtggacgacgaagaggtcaagtccgcgctggccgccgagctgccctacgac
tcgtggctgcacgcgggcctgctcaagctcgccgagctgcccgaccgcgaccacgtcgtg
cagagccacgactccgtgctgcggcgccagctttccttcggctacaccgaagaagagctc
aagatcctgctcgcgccgatggccgagaagggtgccgagccgatcggctcgatgggcacc
gacaccccgcccgcggtgctttcgaagcgatcccggctgctctacgactacttcaagcag
aacttcgcccaggtgaccaacccgccgctggacgcgatccgcgaagagctcgtcacctgc
atggcgcggatcatgggcccggagcgcaacctgctggcccccggcccggcgtcctgccgg
cacctgaagctgccgtacccggtcatcgacaacgacgagctcgccaagctcatccacatc
aacgacgacggcgacctccccggcttcgcctgcagtgtcctttccggactgtacgaagtg
gacggcggtgccgaggcactggcgtcggcgatcgagcgggtccggcgggaggcctccgag
gccatcgcggccggcgcgcgcacgctcgtgctgtccgaccgcgactccgaccaccggatg
gcgccgatcccgtcgctgctgctggtcgccgccgtgcaccaccacctggtccgcaccaag
gaacgcctgcgcgtcgcgctggtcgtcgaatccggtgacgcgcgcgaggtgcaccacatc
gcgctgctgctcggctacggcgccgccgcggtcaacccttacctggccttcgagaccatc
gaagacatgatcgggcagggcgcggtcaccggcatcgagcccgccaaggcgatccgcaac
tacgtgcaggcgctggtcaagggcgtcctgaagatcatgtccaagatgggcatctccacg
gtcggtgcgtacaccgccgcccaggtcttcgaatccctcggcctgagccagaacctgctc
gacgagtacttcaccgggacgtcgtcgaagctcggcggcgtcggcctcgaggtgctcgcc
gaagaggtcgcgacgcgccaccgccgcgcgtacccggaaaacccgaccgaccgcgtccac
cgtggactcgacacgggcggcgagtacgcctaccgccgcgagggcgagctgcacctgttc
acgccggagacggtgttcctgctgcagcacgcgtccaagaccggccgcgacgaggtctac
cgcaagtacaccgaagaggtgcatcgcctctaccgcgagggcggcacgctgcgcgggctg
ttcgcgttcaaggacggcgttcgcgagccggtgccgctcgacgaggtcgagcccgccgag
gcgatcttcaagcgcttcaacacgggcgcgatgtcgtacggctcgatctcggccgaggcg
cacgaaaccctggccatcgcgatgaaccggatcggcggccggtccaacaccggtgagggc
ggcgaagaccccgagcggctctacgaccccgagcgccgcagtgcgatcaagcaggtcgct
tcgggccgcttcggcgtcacgagcgagtacctggtcaacgccgacgacatccagatcaag
atggcgcagggcgcgaagcccggcgagggcggccagctgccgccgaacaaggtgtacccg
tggatcgcgcgcacccggcactccacgccgggcgtcggcctcatttcgccgccgccgcac
cacgacatctactccatcgaggacctggcccagctgatccacgacctcaagaacgccaac
gagcacgcccgcatccacgtgaagctggtgtcctcgctcggcgtcggcacggtcgcggcg
ggcgtgtccaaggcgcacgcggacgtcgtgctcatctccggtcacgacggcggcaccggc
gcgtccccgatgaactcgctcaagcacgccggcacgccgtgggagatcggcctcgccgag
acccagcagacgttgctgctcaacggcttgcgcgaccggatcaccgtccaggtggacggc
gccatgaagaccgggcgcgacgtcgtcatcgcggcgctgctcggcgccgaggagtacggc
ttcgcgacggccccgctcgtcgtcgccggctgcatcatgatgcgcgtctgccacctcgac
acctgcccggtcggcgtcgccacgcagagccccgagctgcgcaagcgctacaccggccag
gtcgagcacgtcgtcaacttcttcaagttcgtcgccgaagaagtccgcgaaaccctggcg
gcgctgggcttccgcacgctcgacgaggccatcgggcacgccgagctgctgaacaccgac
gaggcggtcgagcactggaaggcgtccggtctggacctggcgccgatcttcgagatgccc
tcggagaccccgtacggcggcgccaagcggcgcacccgcggccaggaccacgggctcgag
cacgccctggaccgcacgctgatccagctcgccgaggcggccctggaagacgcgcaccag
gtgaacatcgagctgccggtgcgcaacgtcaaccggaccgtcggcacgctgctcggctcg
gagatcacccgccgctacggcggggacggcctgcccgagggcacgatccacgtcacgctc
accgggtcggcgggccagtcgctcggcgcgttcctgccgcgcggcatcaccctcgacatg
gtcggcgacgcgaacgactacgtcggcaagggcctctccggcggccggatcgtcgtccgc
cccgacccggaggcgtccttcgccgccgaggcgcagacgatcgcgggcaacacgatcgcc
tacggcgccaccggcggcgaaatcttcctgcgcggccaggtcggcgaacgcttctgcgtc
cgcaactccggtgccacggtcgtcgccgagggtgtcggcgaccacgccttcgagtacatg
accggcggccgtgcggtggtgctcggcccgaccgggcgcaacctcgcggccggcatgtcc
ggcggcatcgccttcgtcctcgacgtcgacgcgaagaaggtcaaccaggacatggtggac
ctgctgcggccgaccgccgacgacctggcgtggctgaagaaaaccgtgcaacagcactac
gatctcacccgctccgcggtggcggcctcgctgctcggcgactggccgcgccggtcggtg
gcgttcacgaaggtgatgccgcgcgactaccagcgggtcctggatgcggcgaaggcggcc
cgcgccgccggccgcgacgtcgacgaggcgatcatggaggccgctcgtggctga

KEGG   Amycolatopsis mediterranei U32: AMED_2307Help
Entry
AMED_2307         CDS       T01269                                 

Gene name
gltD
Definition
(RefSeq) glutamate synthase (NADPH/NADH) small subunit
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00910  Nitrogen metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AMED_2307 (gltD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_2307 (gltD)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     AMED_2307 (gltD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4_20 NAD_binding_8 Pyr_redox Amino_oxidase DAO FAD_oxidored NAD_binding_7 HI0933_like FAD_binding_2 AlaDh_PNT_C Pyr_redox_3 FAD_binding_3 FMO-like Thi4 2-Hacid_dh_C NAD_binding_9 GIDA 3HCDH_N Lycopene_cycl NAD_Gly3P_dh_N YjeF_N ApbA TrkA_N F420_oxidored IlvN NAD_binding_2 Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 9436514
NCBI-ProteinID: YP_003764506
UniProt: A0A0H3D1M6
LinkDB All DBs
Position
2457486..2458994
Genome map
AA seq 502 aa AA seqDB search
MADPTGFLKYDREEPKKKSYEERLSSWGEVYADVPSAERNDQVRKQASRCMDCGIPFCHS
GGSGCPLGNLIPEWNDLVRRGDWAAASDRLHATNNFPEFTGKLCPAPCEAGCVLSISPLS
GGPVAIKRVEQTIADQSWEAGYVQPQVSEVSSGRRVAVVGSGPAGLAAAQQLTRAGHEVT
VFERDDRLGGLLRYGIPEFKMEKKVLDRRLAQLRKEGTRFVTGCEVGVDLSVEDLRAQYD
AVVLAVGALRGRDDTTTPGRELAGIHLAMEHLVPANKYVEGDGPPAIDARGKHVVIIGGG
DTGADSYGTATRQGALSVTQLDQYPMPPSARDDERSPWPTWPYILRTYAAHEEAGERKFA
VAVKRFVGSADGRVTGVELQQVRVQKDPATGRREVIPVNDEIETLPADLVLLAIGFEGVE
EMPLLGGLGLSLTRRGTLSCGADWQTESPGVFVCGDAHRGASLVVWAIAEGRSVANAVDT
YLTGASDLPAPVHPTALPLAVV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccgaccggtttcctgaagtacgaccgcgaagagccgaagaagaagtcttac
gaggaacggctttcttcgtggggcgaggtctacgcggacgttccttccgccgagcgcaac
gaccaggtgcgcaagcaggcgtcgcggtgcatggactgcggcatcccgttctgccactcc
ggcggctcgggctgcccgctgggcaatctcatcccggagtggaacgacctggtccgccgc
ggcgactgggccgcggcgagcgaccggttgcacgcgaccaacaacttccccgagttcacc
gggaagctgtgcccggcgccgtgcgaagcgggctgcgtgctgtcgatctccccgctctcc
ggcggcccggtggcgatcaagcgcgtcgagcagacgatcgccgaccagtcctgggaagcg
ggctacgtccagccgcaggtgtccgaagtgtccagtggccgccgggtcgcggtcgtcggc
tccggcccggccgggctcgccgccgcccagcagctgacccgcgccgggcacgaggtcacg
gtgttcgagcgcgacgaccgcctcggcgggctgctgcgctacggcatccccgagttcaag
atggagaagaaggtcctcgaccgccgcctggcgcagctgcgcaaggaaggcacccggttc
gtgacgggctgcgaggtcggcgtcgacctgtcggtggaggacctgcgcgcgcagtacgac
gcggtggtgctcgcggtcggcgcgctgcgcggccgcgacgacacgacgacgccggggcgc
gagctggcgggcatccacctggcgatggagcacctggtcccggccaacaagtacgtcgag
ggcgacggccccccggcgatcgacgcgcgtggcaagcacgtggtgatcatcggcggcggc
gacaccggcgcggactcctacggaacggcgacccgccagggcgcgctgtcggtgacgcag
ctcgaccagtacccgatgccgccgtccgcccgcgacgacgagcggtcgccgtggccgacc
tggccgtacatcctgcgcacgtacgcggcgcacgaggaggcgggtgagcggaagttcgcg
gtggcggtcaagcggttcgtgggttccgccgacggacgcgtgacgggggtggagctgcag
caggtccgcgtccagaaggacccggccaccggacgccgcgaggtgatcccggtgaacgac
gagatcgagacgctcccggcggacctggtgttgctggcgatcggcttcgagggcgtcgag
gaaatgccgctgctgggcggcctcggcctgtcgttgacccgccgcggaaccctgtcctgc
ggcgcggactggcagacggagagcccgggcgtgttcgtctgtggcgacgctcaccgtggg
gcatccctggtggtgtgggcgatcgcggagggccgctcggtggccaacgcggtggacacg
tacttgacgggcgcgtcggacctcccggctccggtccacccgacggcgttgccgctcgcg
gtcgtctga

KEGG   Amycolatopsis mediterranei U32: AMED_7036Help
Entry
AMED_7036         CDS       T01269                                 

Gene name
gltB
Definition
(RefSeq) glutamate synthase (NADPH/NADH) large subunit
  KO
K00265  glutamate synthase (NADPH) large chain [EC:1.4.1.13]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00910  Nitrogen metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AMED_7036 (gltB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_7036 (gltB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amd01002]
    AMED_7036 (gltB)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     AMED_7036 (gltB)
Peptidases and inhibitors [BR:amd01002]
 Cysteine peptidases
  Family C44
   AMED_7036 (gltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG
Motif
Other DBs
NCBI-GeneID: 9441186
NCBI-ProteinID: YP_003769156
UniProt: A0A0H3DGI3
LinkDB All DBs
Position
7773143..7777714
Genome map
AA seq 1523 aa AA seqDB search
MTHRASSLPPSGEQLSNAEAAGLYRSDYEHDACGVAFVADLTGRRDHAIVAKALVALRNL
EHRGARGAEPDTGDGAGLLIQIPDEFYREVVDFELPEPGTYAVGTAFLPQDEKRRGRAMT
TIERIAAEEDMRVLGWRELPVHTEHCGPTAAETMPHFTQLFLTARRPKPEHSDPLHIERS
AFCVRKRVEHELVDDDVYFPSLSSRTIVYKGMLTEPQVERFFADLTDERVTSAIGLVHSR
FSTNTFPSWPLAHPYRYVAHNGEINTLRGNRNWMDAREALLETDLIPGDLKRVYPVITRG
ASDSASFDEVLELLHLGGRSLPHAVLMMIPEAWENHQEMDPARRAFYEFHSTLMEPWDGP
ALVAFTDGSQIGAVLDRNGLRPGRYWVTDDGLVVLASEVGVLDIDPATIVRKGRLEPGRM
FLVDTVEGRIIEDEEVKTELATAHPYDEWVEAGLLQLEDLPERDREVPLHAALVRRQQAF
GYTEEELEAILEPMARTGAEPIGSMGNDSPLATLSSRPRLIFDYFIQLFAQVTNPPLDAI
REELVTALGTQIGAEPNLLLGDAASCRRIALPFPVLDNDQLAKLVHVNDDGDLPEFQAVT
VLGRYNVHGGGEALIKRLDEIRAEVSEAIEDGARLIVLSDRGVDEHHAPIPSLLLTGAVH
HHLVREKTRTQVGLIVEAGDAREVHHIALLIGYGVAAVNPYLAMATVEEMAHQGLIPGVT
PKQATQNLIKALGKGVRKTMSKMGVSTVASYTGAQIFEAIGLGEEVIENCFTGTTSRLGG
VGFETLADEVAKRHKYAFPADGVRAAHRELETGADYQWRREGEPHLFNPQTVFKLQHSTR
AGKYDVFKEYTKAVDDQAEKLLTLRGLFDFKYGKRAPVPIDEVEPVSEIVKRFATGAISY
GSISMEMHQTLAIAMNRLGGKSNTGEGGEDAERLYDPERRSAVKQVASGRFGVTSEYLVN
ADDIQIKMAQGAKPGEGGQLPGAKVYPWIAKTRFSTPGVGLISPPPHHDIYSIEDLAQLI
HDLKNANPNARIHVKLVSEVGVGTVAAGVSKAHADVVLISGHDGGTGASPLSSIKHAGGP
WELGLAETQQTLLANRLRDRIVVQTDGQLKTGRDVIIAALLGAEEFGFATAPLVVSGCIM
MRVCHLDTCPVGVATQNPKLREKFSGKAEYVVNFFEFIAQEVREYLAELGFRSIAEAVGH
AEFLDKRKAVEHWKAAGLDLSPIFHVPDVAPAGLRLQQTKQDHGLEKALDNTLIQLAEGA
LNSGDKVRLELPVRNVNRTVGTMLGSELTKRWGGEGLPDDTIDVTFTGTAGQSFGAFVPK
GITLRLYGDGNDYVGKGLSGGRLIVRPPREAQYTAEEQIIAGNVIGYGATSGEIFIRGKV
GERFCVRNSGALAVVEGVGDHGGEYMTGGRMVVLGPIGRNFAAGMSGGIAYVLDLPAHRV
NPEMVDLDPLDSEDADFLRETLEKHYNETESAVARELLADWDAGVDRFGKVMPKDYKRVL
AAQVQAERDGRDVNEAIMEAAHG
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaccgtgccagttccctgcccccgtccggggagcagctcagcaacgccgaggcc
gcgggcctctaccggagcgactacgaacacgacgcctgcggtgtcgccttcgtcgccgac
ctgaccgggcgccgagatcatgcgatcgtcgccaaggctttggttgcgttgcgcaatctg
gaacaccgcggggctcgtggcgccgaaccggacaccggcgacggcgccgggctcctgatc
cagatcccggacgagttctaccgcgaggtcgtggacttcgagctccccgagccgggcacc
tacgccgtcggcacggctttcctgccgcaggacgaaaagcgccgcggccgggccatgacg
accatcgagcgcatcgccgccgaggaggacatgcgcgtcctcggctggcgcgagctgccg
gtgcacaccgagcactgcgggccgaccgcggccgagaccatgccgcacttcacgcagctg
ttcctcaccgcgcgccgcccgaagccggagcactcggacccgctgcacatcgagcgcagc
gcgttctgcgtccgcaagcgcgtggagcacgagctcgtcgacgacgacgtgtacttcccg
tcgctctcctcgcggacgatcgtctacaaaggaatgctcaccgagccccaggtcgagcgg
ttcttcgccgacctgaccgacgagcgcgtcaccagcgccatcgggctggtgcactcccgc
ttctccaccaacaccttcccgtcgtggccgctggcccacccgtaccggtacgtggcgcac
aacggcgagatcaacacgctgcgcggcaaccgcaactggatggacgcccgcgaggcgctg
ctggagaccgacctgatcccgggcgacctcaagcgcgtctacccggtgatcacccgcggc
gccagcgactcggcgagcttcgacgaggtcctggagctgctgcacctcggcggccgctcg
ctgccccacgccgtcctgatgatgatcccggaggcctgggagaaccaccaggagatggac
ccggcgcgacgcgccttctacgagttccactcgacgctgatggagccgtgggacggcccg
gcgctggtcgccttcaccgacggttcgcagatcggggcggtcctcgaccgcaacggcctg
cgccccggccggtactgggtgaccgacgacggcctcgtcgtgctcgcctccgaggtcggc
gtgctcgacatcgacccggcgacgatcgtccggaagggacgcctcgagcccggccggatg
ttcctcgtggacaccgtcgaaggccggatcatcgaggacgaagaggtcaaaaccgaactg
gccaccgcccacccgtacgacgagtgggtcgaggccgggctgctccagctggaggacctg
ccggagcgcgaccgcgaggtcccgctgcacgccgcgctcgtccgccgccagcaggcgttc
ggctacaccgaggaagagctcgaggccatcctcgagccgatggcccgcaccggcgcggag
ccgatcggctcgatgggcaacgactcgccgctcgcgacgctctcgagccgcccgcggctg
atcttcgactacttcatccagctgttcgcccaggtgacgaacccgccgctggacgccatc
cgcgaggagctcgtcaccgcgctcggcacccagatcggcgccgagccgaacctcctgctc
ggcgacgccgcgagctgccgccggatcgcgctgccgttcccggtgctcgacaacgaccag
ctcgccaagctggtgcacgtcaacgacgacggcgacctgccggagttccaggcggtcacc
gtgctcggccggtacaacgtgcacggcggcggcgaggcgctgatcaagcggctggacgag
atccgcgccgaggtgtccgaggcgatcgaggacggcgcccggctgatcgtgctgtccgac
cgcggggtcgacgagcaccacgcgccgatcccctcgctgctgctgaccggcgcggtgcac
caccacctcgtccgcgagaagacgcgcacgcaggtcggcctcatcgtcgaggccggcgac
gcgcgcgaggtgcaccacatcgcgctgctcatcggctacggcgtcgccgcggtgaacccg
tacctggcgatggccaccgtcgaggagatggcccaccagggcctgatcccgggcgtgacg
ccgaagcaggcgacgcagaacctgatcaaggcgctcggcaagggcgtccgcaagacgatg
tcgaagatgggcgtttcgaccgtcgcgtcctacaccggcgcgcagatcttcgaggcgatc
gggctcggcgaagaggtcatcgagaactgcttcaccggcacgacgtcccgcctcggcggc
gtcggcttcgagacgctcgccgacgaggtcgcgaagcggcacaagtacgccttcccggcc
gacggcgtccgggccgcccaccgcgagctcgaaacgggcgcggactaccagtggcgccgc
gagggcgagccgcacctgttcaacccgcagacggtgttcaagctccagcactccacgcgg
gccgggaagtacgacgtcttcaaggagtacacgaaggccgtcgacgaccaggccgagaag
ctgctgacgctgcgcgggctgttcgacttcaagtacggcaagcgggcgccggtgccgatc
gacgaggtcgaaccggtttcggagatcgtcaagcggttcgccaccggcgccatctcctac
ggctcgatctcgatggagatgcaccagaccctcgccatcgcgatgaaccgcctcggcggg
aagtccaacaccggcgaaggcggcgaagatgcggagcggctgtacgacccggagcggcgt
agcgccgtgaagcaggtcgcgtccggccggttcggcgtcacgagcgagtacctcgtcaac
gccgacgacatccagatcaagatggcgcagggcgcgaagcccggcgagggcgggcagctg
cccggcgcgaaggtgtacccgtggatcgcgaagacgcggttctcgacgccgggcgtcggc
ctgatttcgccgccgccgcaccacgacatctactcgatcgaagacctcgcccagctgatc
cacgacctgaagaacgccaacccgaacgcgcgcatccacgtgaagctcgtgtccgaggtc
ggcgtcgggacggtcgccgcgggtgtgtccaaggcgcacgcggacgtcgtgctcatctcg
ggccacgacggcgggaccggcgcttcgccgctgtcgtccatcaagcacgccggcggcccg
tgggagctcggcctggccgagacgcagcagacgctgctggccaaccggctgcgcgaccgg
atcgtcgtgcagaccgacggccagctcaagaccggccgcgacgtgatcatcgcggcgctg
ctcggcgccgaggagttcggcttcgcgaccgcgccgctggtggtgtcgggctgcatcatg
atgcgcgtctgccacctcgacacctgcccggtgggtgtcgcgacgcagaacccgaagctg
cgcgagaagttcagcggcaaggccgagtacgtcgtcaacttcttcgagttcatcgcccag
gaagtccgggagtacctggcggagctgggtttccggtcgatcgccgaggccgtcgggcac
gccgagttcctcgacaagcgcaaggcggtcgagcactggaaggcggccgggctcgacctg
tcgccgatcttccacgtgcccgacgtggccccggccgggctgcgcctgcagcagacgaag
caggaccacggcctcgagaaggccttggacaacacgctgatccagctggccgagggtgcg
ttgaactccggcgacaaggtgcggctggaactgcccgtccgcaacgtgaaccggaccgtc
ggcaccatgctcggctcggagctgaccaagcggtggggcggcgaagggctgccggacgac
accatcgacgtcaccttcaccgggacggcaggccagtcgttcggcgcgttcgtgccgaag
ggcatcacgctgcggctctacggcgacggcaacgactacgtcggcaagggcctctccggc
ggacggctgatcgtgcggccgccgcgggaagcgcagtacaccgccgaagagcagatcatc
gccggcaacgtcatcggctacggcgcgaccagcggcgagatcttcatccgcggcaaggtc
ggcgagcggttctgcgtgcgcaactcgggcgcgctggccgtcgtcgaaggcgtcggcgac
cacggcggcgagtacatgaccggcggccggatggtcgtgctcggcccgatcgggcgcaac
ttcgcggccggcatgtccggcggcatcgcctacgtgctggacctgcccgcgcaccgcgtc
aacccggagatggtcgacctcgacccgctcgactccgaggacgcggacttcctgcgcgaa
acgctggaaaagcactacaacgaaacagaatccgcggtcgcgcgggaactgctggccgac
tgggacgcgggcgtcgaccgcttcgggaaggtcatgccgaaggactacaagcgcgtgctc
gccgcccaggtgcaggccgagcgcgacgggcgcgacgtgaacgaggcgatcatggaggcc
gcacatggctga

KEGG   Amycolatopsis mediterranei U32: AMED_7037Help
Entry
AMED_7037         CDS       T01269                                 

Gene name
gltD
Definition
(RefSeq) glutamate synthase (NADPH/NADH) small subunit
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00910  Nitrogen metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AMED_7037 (gltD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_7037 (gltD)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     AMED_7037 (gltD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4_20 NAD_binding_8 Pyr_redox Amino_oxidase FAD_oxidored HI0933_like Pyr_redox_3 FAD_binding_3 Thi4 FAD_binding_2 DAO NAD_binding_7 GIDA FMO-like AlaDh_PNT_C Lycopene_cycl 3HCDH_N IlvN F420_oxidored NAD_binding_9 2-Hacid_dh_C NAD_Gly3P_dh_N YjeF_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 9441187
NCBI-ProteinID: YP_003769157
UniProt: A0A0H3DCW2
LinkDB All DBs
Position
7777707..7779158
Genome map
AA seq 483 aa AA seqDB search
MADPKGFLTTTREEPKRRPVDLRLMDWREVYEDFATTKLQKQAGRCMDCGIPFCHQGCPL
GNLIPEWNTLTWREDWQQAIERLHATNNFPEFTGTLCPAPCETACVLGINDDPVTIKRVE
ISIIDRAFDEGWVTPQLPIALTGKKVAVVGSGPSGLAAAQQLTRAGHSVVVLERADKIGG
LLRYGIPEFKMEKSRLDRRLDQMRAEGTEFRTSVNVGVDISAAELRSSYDAVVLAGGATD
WRDLPIPGRELAGIHQAMEFLPPANRVASGDLESSPFDAAGLDVVVIGGGDTGADCVGTS
HRQGARSVTQLEIMPKPPEARSDAHPWPTYPMIYRVSSAHEEGGERLYAVNTQEFLGDAD
GRVRALKLVEVRNEGGKFVPVPGSERELPAQLVLLAMGFLGPQKKGLIEDLGVELDARGN
VARDKAFKTSLDNVFVAGDMGRGQSLIVWAIAEGRSAAAGVDAYLTGRDVLPRPIAPTDR
PIA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccccaagggctttctgaccaccacccgcgaagagccgaagcggcgtccggtc
gacctgcggctgatggactggcgagaggtctacgaagacttcgccacgacgaagctgcag
aagcaggccggccggtgcatggactgcggcatcccgttctgccaccagggctgcccgctg
gggaacctcatccccgagtggaacacgctgacctggcgcgaggactggcagcaggccatc
gaacggctgcacgcgacgaacaacttcccggagttcaccgggacgttgtgcccggcaccc
tgcgaaaccgcgtgcgtgctcgggatcaacgacgacccggtgacgatcaagcgggtcgag
atctcgatcatcgaccgggccttcgacgagggctgggtgacaccgcagctgcccattgcc
ctcacaggcaagaaggtcgcggtcgtcgggtccgggccgtcgggtcttgccgcggcgcag
cagctgacgcgcgcgggccacagcgtcgtggtcctcgagcgggccgacaagatcggcggg
ctgctgcgctacggcatccccgagttcaagatggagaagtcgcgcctcgaccggcggctc
gaccagatgcgcgccgaggggacggagttccggacgtcggtgaacgtcggtgtggacatc
tccgccgccgagctccggtcgtcctacgacgccgtggtgctggccggtggcgcgaccgac
tggcgcgacctgccgatccccggccgggaactggccggcatccaccaggcgatggagttc
ctcccgccggccaaccgggtcgcttcgggggatctcgagtcgtctcccttcgacgccgcg
ggcctggacgtcgtggtcatcggtggcggcgacacgggcgcggactgcgtcgggacatcg
caccgccagggcgcgcgttcggtgacgcagctggagatcatgcccaagccgcccgaggcg
cgatcggacgcgcacccgtggccgacgtacccgatgatctaccgggtgtcctcggcgcac
gaagaaggcggcgagcggctctacgcggtgaacacgcaggagttcctgggtgacgccgac
ggccgcgtgcgcgcgctgaagctggtcgaggtgcgcaacgagggcggcaagttcgtcccg
gtgcccggttcggaacgcgagctgccggcgcagctggtcctgctggcgatgggcttcctc
gggccgcagaagaagggcctcatcgaggacctgggcgtcgaactggacgcgcgcggcaac
gtggcgcgcgacaaggcgttcaagacgagcttggacaacgtgttcgtggccggcgacatg
ggccgcggccagtccctgatcgtctgggcgatcgcggagggccgcagcgccgcggccggc
gtcgacgcctacctgaccggccgcgacgtcctgccccgcccgatcgcgccgacggaccgg
ccgatcgcgtaa

DBGET integrated database retrieval system