KEGG   Amycolatopsis mediterranei U32: AMED_2597Help
Entry
AMED_2597         CDS       T01269                                 

Definition
(RefSeq) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00500  Starch and sucrose metabolism
amd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMED_2597
Enzymes [BR:amd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMED_2597
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMED_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 9436802
NCBI-ProteinID: YP_003764794
UniProt: A0A0H3D295
LinkDB All DBs
Position
2775542..2777350
Genome map
AA seq 602 aa AA seqDB search
MAEEARPDAALGLDGVPHTGEAMTADGMLVEPQAGDFRSAQQAPSNPEWFKGAVFYEVLV
RAFADSNGDGTGDLRGLAGRLDYLAWLGIDCLWLPPFYASPLRDGGYDISDFRAVLPEFG
SVEDFVFLLNEAHRRGIRVITDLVLNHTSDAHPWFQQSRSDPDGPYGDYYVWSDDDSRYA
DARIIFVDTETSNWTYDPVRGQFYWHRFFSHQPDLNFENVDVQNAMIDTLRFWLDLGIDG
FRLDAVPYLFEQEGTNCENLPRTHEFLKRCRKVVDDEYPGRILLAEANQWPSDVVEYFGD
PAVGGDECHMAFHFPLMPRIFMAVRRESRFPISEILTQTPTIPSGAQWGIFLRNHDELTL
EMVTDEERDYMYAEYAKDPRMKANIGIRRRLAPLLDNDRNQQELFTAMLLSLPGSPVLYY
GDEIGMGDNIWLGDRDAVRTPMQWTPDRNAGFSSCDPGRIYLPVIMDPVYGYQGLNVEAQ
SNNASSLLNWTRRMIEVRKQHHAFAEGEFVDLGGSNPSVLAYKRQWRRPDGGEDVVLCVN
NLSRFPQPVELDLSAHRGCTPVELTGGVRFPSIGDLSYLLTLPGHGFYWFQLTSPGDEGE
AR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaagcccggcccgacgcggcgttggggctggacggtgtgccgcacaccggt
gaggcgatgaccgccgacggcatgctggtcgaaccgcaggccggggacttccggtcggcg
cagcaggcgccgagcaacccggagtggttcaagggcgcggtgttctacgaagtgctggtg
cgcgcgttcgccgactccaacggcgacggcaccggcgatctgcgcggcctggccggccgg
ctcgactacctggcctggctgggcatcgactgcctgtggctgccgccgttctacgcctcg
ccgctgcgcgacggcgggtacgacatcagtgacttccgcgcggtgctgccggagttcggc
agcgtcgaggacttcgtcttcctgctcaacgaggcccaccggcggggcatccgggtgatc
accgacctggtgctcaaccacacctcggacgcgcacccgtggttccagcagtcccgcagc
gaccccgacggcccgtacggcgactactacgtgtggagcgacgacgactcgcgctacgcc
gacgcccggatcatcttcgtcgacaccgagacgtcgaactggacctacgatccggtgcgc
ggccagttctactggcaccggttcttctcccaccagcccgacctgaacttcgagaacgtc
gacgtccagaacgcgatgatcgacaccctgcggttctggctggacctgggcatcgacggg
ttccgcctggacgccgtgccgtacctgttcgagcaggagggcaccaactgcgagaacctg
ccgcgcacgcacgagttcctcaagcgctgccgcaaggtcgtcgacgacgagtacccgggc
cggatcctgctggccgaggcgaaccagtggccctcggacgtcgtcgagtacttcggcgac
ccggcggtcggcggcgacgagtgccacatggcgttccacttcccgctgatgccccggatc
ttcatggcggtgcggcgtgagtcccggttcccgatctcggagatcctcacccagaccccg
accatccccagcggggcccagtggggcatcttcctgcgcaaccacgacgagctgaccctc
gagatggtcaccgacgaagagcgcgactacatgtacgcggagtacgccaaggacccgcgc
atgaaggccaacatcggcatccgccgccggctggccccgctgctggacaacgaccggaac
cagcaggagctgttcacggcgatgctgctgtccctccccggttcgcccgttctgtactac
ggtgacgagatcggcatgggagacaacatctggctcggcgatcgcgacgcggtgcgaacc
cccatgcagtggaccccggaccgcaacgccgggttctcctcctgcgacccgggccgcatc
tacctgccggtgatcatggacccggtgtacggctaccagggcctgaacgtcgaggcgcag
tcgaacaacgcgtcttcgctgctcaactggacccgccggatgatcgaggtgcgcaagcag
caccacgcgttcgccgagggcgagttcgtcgacctcggcggctccaacccgagcgtgctg
gcctacaagcgccagtggcggcgcccggacggcggcgaagacgtcgtgctctgcgtgaac
aacctctcccggttcccgcagccggtggagctggatctgtccgcgcaccgcgggtgcacg
ccggtggagctcaccggcggcgtgcggttccccagcatcggggacctgtcgtacctgctg
acgctgcccgggcacggcttctactggttccagctgacgagcccgggagacgaaggcgaa
gcgaggtga

DBGET integrated database retrieval system