KEGG   Amycolatopsis mediterranei U32: AMED_2669Help
Entry
AMED_2669         CDS       T01269                                 

Gene name
lig
Definition
(RefSeq) ATP-dependent DNA ligase
Organism
amd  Amycolatopsis mediterranei U32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 9436874
NCBI-ProteinID: YP_003764866
UniProt: A0A0H3D0N1
LinkDB All DBs
Position
complement(2854902..2855981)
Genome map
AA seq 359 aa AA seqDB search
MPLPLQPPLKPMLAKPAKAIPESGGLLFEPKWDGFRCIVFRDGDELYLQSRAEKPLNRYF
PEAVARLLDTLPPRVVLDGELVVARDGRLNFDALTERIHPAESRITLLSAEQPAEFVAFD
VLALGDDLLLDEPTSVRRERLTELAGDRFPLTPATTDPATARHWFELFEGAGLDGVIGKP
LDEPYTPGKRVMLKYKHLRTADCVLAGLRWHVDGGPGELVGSFLLGLYDEKGVLHHVGTV
GAFPKDRRRELAEELAPLITDGEDHPWGGRATGEAQRIPGGITRWRATEHEWVPLRPERV
VEVAYENTEGGMPSRFRHNARFKRWRPDREPASCDYSQLEEPARYDLDAVFRGQVVRTR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccctaccgctgcagccgccgctgaagccgatgctcgccaagcccgccaaggccatc
cccgaatccggtggcctgctgttcgaaccgaagtgggacggcttccgctgcatcgtcttc
cgcgacggcgacgagctgtacctgcagtcgcgcgcggaaaagccgctcaaccggtacttc
ccggaggccgtcgcgcggctgctggacaccctgccgccgcgggtcgtgctcgacggcgag
ctcgtcgtcgcgcgcgacggacggctgaacttcgacgccctcaccgagcgcatccacccc
gccgaaagccggatcacgctgctgtccgccgagcagcccgccgagttcgtcgccttcgac
gtcctggccctgggggacgatctgctgctcgacgaaccgacgtccgtccgccgcgaacgc
ctcaccgaactggccggcgaccggttcccgctcaccccggcgaccaccgatcccgccacc
gcgcgccactggttcgagctgttcgaaggcgccggcctcgacggcgtcatcggcaagccg
ctcgacgagccctacacccccggcaagcgcgtgatgctcaagtacaagcacctgcgcacc
gccgactgcgtgctcgccggcctgcgctggcacgtcgacggcggcccgggcgaactcgtc
ggctccttcctgctcggcctgtacgacgaaaagggcgtgctgcaccacgtcggcaccgtc
ggggcgttccccaaggaccgccgccgcgaactcgccgaagagctggcgccgctgatcacc
gacggcgaggaccacccgtggggcggccgggccaccggtgaggcccagcgcatccccggc
ggcatcacccgctggcgcgccaccgagcacgaatgggtaccgctgcggcccgagcgcgtc
gtcgaggtcgcctacgagaacaccgaaggcggcatgccgtcgcggttccggcacaacgcg
cggttcaagcgctggcggcccgaccgcgaacccgcgtcgtgcgactacagccagctcgag
gagccggcccgctacgacctcgacgccgtcttccgcggccaggtggtgcggacccgctaa

DBGET integrated database retrieval system