KEGG   Amycolatopsis mediterranei U32: AMED_3255Help
Entry
AMED_3255         CDS       T01269                                 

Gene name
lig
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:amd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AMED_3255 (lig)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amd03400]
    AMED_3255 (lig)
Enzymes [BR:amd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMED_3255 (lig)
DNA repair and recombination proteins [BR:amd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AMED_3255 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 9437455
NCBI-ProteinID: YP_003765447
UniProt: A0A0H3D331
LinkDB All DBs
Position
complement(3510697..3512709)
Genome map
AA seq 670 aa AA seqDB search
MAADDASLVPAWLEPMLAKADGGRLRTGPEWAYEYKLDGYRAAMRIAPDGTTVLTSRNNI
DFTAEFTDLEGVLAPALDGRAAYLDGEIVVYGEDGRIDFERMQERRGRYVRHQSGPKGRE
FTDVPVRFLAFDLLRLGDESLLAMPYDERRRLLAELPMPDPYRVSVVRAVTFDELAADRR
TPADFLAHAASAGYEGVVAKLRSSAYHPGQRPDSWLKHPLVRTQEVIVCGWRPGQNSFTG
TLGGLLLGAHDPATGDLVYIGDVGTGFSQATRADLRAQLEAMERRTHPFVTTPPREDTAR
ARWVEPRLVGEIVYRQFTRGGRVRHTAWRGLRHDKDPAEVLAPRAVPHEPAGAAPAPPSP
SSSASASASPSPEPAGQRITVQAGDRRLTLSNLDKVLYPADGFTKGEVINYYSRVAAVLL
PHLAGRPVTFIRYPNGVDGQKWFEKNAPKGAPDWLRTVRLAGTGGTIDYPLLDDLPGLVW
AANMAALELHVPQWTVEQGTRQPPDRLVFDLDPGPGTTIVDCCRVAERLHDVLVADGLTP
YAKTSGSKGMQLYCGIRTDDPAAPSAYAKRLAQRLAKETPESVTAVMAKAQRTGRVFIDW
SQNNPAKTTVAPYSLRGRDHPTASTPVTWDEVRACRHVNRLTFTADDVLDRLEDHGDLLA
GLIEDRAPLG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagacgacgcgtcgctcgtcccggcctggctggagccgatgctcgccaaggcc
gacggcgggcggctgcgcaccggcccggagtgggcctacgagtacaaactggacggttac
cgggcggccatgcggatcgccccggacggcaccaccgtgctcaccagccgcaacaacatc
gacttcaccgcggagttcaccgacctcgagggcgtgctcgcccccgcactggacggccgc
gccgcctacctggacggcgagatcgtcgtctacggcgaggacggccggatcgacttcgag
cggatgcaggagcgccgcggccgctacgtccggcaccagagcgggccgaaggggcgggag
ttcaccgacgtcccggtccggttcctggccttcgacctgctccggctcggggacgagagc
ctgctggccatgccgtacgacgagcgccgccggctgctggccgagctgccgatgcccgat
ccgtaccgcgtttcggtggtccgcgcggtcaccttcgacgagctcgccgccgatcgccgc
acccccgcggacttcctcgcccacgccgcgtccgccgggtacgagggcgtcgtcgcgaaa
ctgcggtcgtcggcctaccaccccgggcagcggccggattcgtggctcaagcacccgctg
gtccggacgcaggaggtgatcgtctgcggctggcggcccgggcagaacagcttcaccggc
accctcggcgggctcctgctcggcgcgcacgaccccgcgaccggcgacctggtctacatc
ggcgacgtcggcaccggcttcagccaggccacccgcgccgacctgcgggcgcagctggag
gcgatggagcgccgcactcacccgttcgtgacgacgccgccgcgggaggacaccgcccgc
gcccgctgggtggagccgcggctggtcggcgagatcgtctaccgccagttcacccgcggt
ggccgcgtccgccacaccgcctggcggggcctgcgccacgacaaggacccggccgaggtc
ctggcgccgcgcgcggttccgcacgaacccgccggcgcggctccggcaccgccttcgccc
tcgtcgtcggcttcggcgtcggcgtcgccttcacccgagccggcggggcagcggatcacc
gtccaggccggcgatcggcggctcacactgtccaatctggacaaggtgctgtacccggcg
gacggcttcaccaagggcgaggtgatcaactactactcccgcgtcgcggcggtgctgctg
ccgcacctcgccgggcggccggtgacgttcatccgctacccgaacggcgtcgacggccag
aagtggttcgagaagaacgccccgaagggcgccccggactggctgcgcacggtgcgcctg
gccggcacgggcggcacgatcgactacccgctcctggacgacctcccgggcctggtgtgg
gcggcgaacatggcggcgctcgagctgcacgttccccagtggacggtggagcagggcacc
cggcagcccccggaccggctggtgttcgacctggacccgggcccgggcacgacgatcgtc
gactgctgccgggtggcggagcgcctgcacgacgtcctggtcgccgacgggctgacaccg
tacgcgaaaacgtcgggctccaagggaatgcagctctactgcggaatccgcacggacgac
ccggcggccccgtcggcgtacgccaagcggctcgcccagcgcctggcgaaggagacaccg
gagtcggtgacggcggtgatggcgaaggcccagcgcacgggccgggtgttcatcgactgg
agccagaacaacccggcgaagacgacggtggccccgtattcgttgcgcggccgcgaccac
ccgacggcgtcgaccccggtgacgtgggacgaggtgcgagcttgccgccacgtgaaccgc
ttgacgttcacggcggacgacgtcttggaccgcctcgaagaccacggcgatctgctggcg
ggactgatcgaggaccgcgcgccgctggggtga

DBGET integrated database retrieval system