KEGG   Amycolatopsis mediterranei U32: AMED_4600Help
Entry
AMED_4600         CDS       T01269                                 

Gene name
glsA
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00220  Arginine biosynthesis
amd00250  Alanine, aspartate and glutamate metabolism
amd00471  D-Glutamine and D-glutamate metabolism
amd01100  Metabolic pathways
amd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_4600 (glsA)
   00220 Arginine biosynthesis
    AMED_4600 (glsA)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMED_4600 (glsA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMED_4600 (glsA)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AMED_4600 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 9438782
NCBI-ProteinID: YP_003766772
UniProt: A0A0H3D5U5
LinkDB All DBs
Position
5061904..5062809
Genome map
AA seq 301 aa AA seqDB search
MDLAALLDRIADDVAPEVGRGAVADYIPALARVAPGRFGMAVAEVDGAVHGVGDWEHPFS
VQSMSKVFTLALTLSRGDDVWARVGREPSGDPFNSLVQLEHEDGIPRNPFINAGALVVTD
ELARHGDAVDALLAFLRQESGRAGIAVDPEVAASEAGHADRNRALAYFMASYGNMRHPVP
SVLDQYVRQCSIAMSCADVARSALFLARHGVRNDGSRLLGLSAAKRINAVMLTCGTYDAA
GEFAYRVGLPGKSGVGGGVLAIVPGRCAVCVWSPGLDARGNSVAGVAALDRFTTLTGWSI
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcgcggcgctgctggaccggatagccgacgacgtcgcgcccgaggtcggccgc
ggcgccgtcgctgactacattcccgcgctggccagggtggcgccggggcggttcggcatg
gcggtggccgaagtggacggtgcggtgcacggcgtcggcgactgggagcacccgttctcc
gtgcagagcatgtccaaagtgttcaccctcgcgctgaccctttcccgcggcgacgacgtg
tgggcgcgggtcggccgcgaaccgtcgggtgatccgttcaattcgctggtgcagctcgaa
cacgaggacggcattccgcgcaacccgttcatcaatgcgggcgcgctggtggtgaccgac
gaactcgcccgccacggcgacgcggtggacgcgctgctcgccttcctccggcaggagagc
ggccgtgcggggatcgccgtggatcccgaggtggcggcgtcggaggcggggcacgccgac
cgcaaccgcgccctcgcgtacttcatggcgtcctacggcaacatgcgccacccggtgccg
tcggtgctggaccagtacgtccgccagtgttcgatcgcgatgagctgcgccgacgtcgcc
cggtcggcgttgttcctggcccgccacggcgtccgcaacgacggctcgcggctgctcggg
ctgagcgcggcgaagcggatcaacgcggtgatgctgacgtgcggcacgtacgacgcggcg
ggcgagttcgcctaccgcgtcggcctcccgggcaagagcggcgtgggcggcggcgtcctg
gcgatcgtcccgggccggtgcgcggtctgcgtgtggagccccgggctggacgcgcgcggc
aactccgtggccggtgtggcggccctggaccggttcacgacgctgaccggctggtcgatc
ttctga

KEGG   Amycolatopsis mediterranei U32: AMED_9050Help
Entry
AMED_9050         CDS       T01269                                 

Gene name
purL
Definition
(RefSeq) phosphoribosylformylglycinamidine synthase
  KO
K23265  phosphoribosylformylglycinamidine synthase subunit PurQ / glutaminase [EC:6.3.5.3 3.5.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00220  Arginine biosynthesis
amd00230  Purine metabolism
amd00250  Alanine, aspartate and glutamate metabolism
amd00471  D-Glutamine and D-glutamate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
Module
amd_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AMED_9050 (purL)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_9050 (purL)
   00220 Arginine biosynthesis
    AMED_9050 (purL)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMED_9050 (purL)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AMED_9050 (purL)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     AMED_9050 (purL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_5 GATase_3 GATase DJ-1_PfpI Peptidase_C26 SNO
Motif
Other DBs
NCBI-GeneID: 9443185
NCBI-ProteinID: YP_003771141
UniProt: A0A0H3DM41
LinkDB All DBs
Position
complement(9900867..9901544)
Genome map
AA seq 225 aa AA seqDB search
MSARIGVITFPGTLDDGDAARAVRYAGGEAVSLWHADEDLRDVDAVVVPGGFSYGDYLRA
GVIARFAPVMTPVIEAARAGMPVLGICNGFQILCEAGLLPGAMIRNQGLHFICRDQWLRV
ENTDTAWTTRYETGAEILIPMKNIDGCYMAEQSTLDELEGEGRVVFRYVGGNPNGSRNDI
AGIRSENGRVVGLMPHPEHAIDALTGPSDDGLGMFFSAVDALVKA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcgcatcggcgtcatcaccttcccgggcaccctggacgacggtgacgcggcg
cgcgcggtccgctacgccggcggcgaggccgtgtcgctgtggcacgccgacgaggacttg
cgcgacgtcgacgccgtggtcgtcccgggcggtttctcctacggcgactacctgcgtgcg
ggcgtgatcgcccggttcgcgccggtcatgacgccggtgatcgaggcggcccgcgcgggc
atgccggtgctcggcatctgcaacgggttccagatcctgtgcgaagccggcctgctgccg
ggcgcgatgatccgcaaccagggcttgcacttcatctgccgcgaccagtggctgcgggtg
gagaacaccgacacggcgtggaccacccggtacgagaccggagccgagatcctcatcccg
atgaagaacatcgacggctgctacatggccgagcagtccactttggacgagctggagggc
gagggccgtgtggtgttccggtacgtcggcgggaacccgaacggctcgcgcaacgacatc
gccggcatccgcagcgagaacggccgggtcgtcgggctgatgccgcacccggagcacgcg
atcgacgcgctgaccgggccgtcggacgacgggctcggcatgttcttcagcgcggtggac
gcgctcgtgaaggcgtga

DBGET integrated database retrieval system