KEGG   Amycolatopsis mediterranei U32: AMED_4761Help
Entry
AMED_4761         CDS       T01269                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00220  Arginine biosynthesis
amd00250  Alanine, aspartate and glutamate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01230  Biosynthesis of amino acids
Module
amd_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_4761 (argH)
   00220 Arginine biosynthesis
    AMED_4761 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amd04147]
    AMED_4761 (argH)
Enzymes [BR:amd01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     AMED_4761 (argH)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMED_4761 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 9438939
NCBI-ProteinID: YP_003766929
UniProt: A0A0H3D886
LinkDB All DBs
Position
complement(5236759..5238300)
Genome map
AA seq 513 aa AA seqDB search
MTAELGALRDGRSASTLCARAAGIVFGADTGPAMAAELDRITAVDQAHVVMLAERELIGP
AAAAELLREIQFLRADDFAELRGRRAPRGLYLLYESHLIERLGREIGGVLHTGRSRNDLK
ATVHKLRLRAVLAGLVRELLRLQAVTLGRARRHRVTVMPVYSQFQPSVPGSYGWYLLGIA
EALDHDIDGLVRAGEGLRECPLGAAGGAGTDVRLDPARTADLLGFTEPVRHAGYAIASRD
TMLRILSAAVLAGLTLSRLATDLQLWSTPEFDLVEFPDHLVGISSAMPQKRNPFLLEVIK
GASGALIGAWTAAVATTKNTPFGNSVEVSTEGVAPGWAALDTLGDQVQLSISVLAGARPR
PERMLAGAHHGYTVATAIANRLVAQGVPFRSAHTATGRLVTELIAEGVTSFAAVPPGELA
ARLGAALGTEVRLGAADLDPAEVVRATDFGGGPGARSFALAHTRLARRWRVQVRQLTAEE
RRRRTARRRRARAVTALIDGRAEARRPGNGGRP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgagctcggtgccctgcgcgacggccggtcggcgtcgacgctctgcgcccgc
gcggccggcatcgtgttcggtgcggacaccggtcccgcgatggcggcggaactggaccgc
atcaccgcggtcgaccaggcgcacgtcgtcatgctcgcggagcgggagctgatcgggccg
gccgcggcggccgagctgctgagggagatccagttcctgcgcgccgacgatttcgccgag
ctgcgtggccggcgcgcgccgcggggcctgtacctgctctacgagagccacctgatcgag
cggctcggccgcgagatcggtggcgtgctgcacaccggccggtcccgcaacgatctgaag
gcgaccgtccacaagctgcgcctgcgtgccgtgctcgccggcctcgtccgggaactgctg
cgcctgcaggccgtgacgctcggccgggcccggcggcaccgggtcaccgtgatgcccgtc
tacagccagttccagccatcggtgccggggagctacggctggtacctgctcggcatcgcc
gaggcgctcgaccacgacatcgacggcctcgtgcgggccggcgaggggctgcgggagtgc
ccgctcggcgcggccggcggcgcgggcaccgacgtgcggctcgacccggcccgtaccgcg
gatctgctcgggttcaccgagccggtccgccacgccgggtacgcgatcgcctcgcgggac
accatgctccggatcctctccgccgccgtgctggccgggctgacgctctcccggctggcc
accgacctgcagctgtggagcaccccggagttcgacctcgtcgagttcccggaccacctg
gtcggcatcagctcggccatgccgcagaagcgcaaccccttcctgctcgaggtcatcaag
ggcgcctcgggcgcgctgatcggggcgtggaccgcggcggtggccacgacgaagaacacc
ccgttcggcaattcggtcgaggtgagcaccgagggggtggcgcccggctgggcggcgctg
gatacgttgggggaccaagtgcagttgtcgatctcggtgctggccggcgcccggccgcgg
ccggagcgcatgctcgccggggcgcaccacgggtacacggtggcgaccgcgatcgcgaac
cggttggtggcccagggtgttcccttccgctcggcgcacacggcgaccgggcggctggtg
accgagctgatcgccgaaggcgtcacctcgttcgccgcggtgccgcccggcgagctggcc
gctcgcctcggcgctgcgctcggcaccgaggtgcggctcggggccgccgacctcgatccg
gccgaggtggtccgggcgacggacttcggcggcgggccgggagcccggtcgttcgcgctc
gcccacacccggctggcccgccggtggcgggtccaggtgcggcagctgacggccgaagag
cggcggcgccggacggcccggcggcggcgggcgcgggcggtcaccgccctgatcgacggg
cgggccgaggcccggcgcccggggaacggaggccgcccgtga

KEGG   Amycolatopsis mediterranei U32: AMED_6037Help
Entry
AMED_6037         CDS       T01269                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00220  Arginine biosynthesis
amd00250  Alanine, aspartate and glutamate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01230  Biosynthesis of amino acids
Module
amd_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_6037 (argH)
   00220 Arginine biosynthesis
    AMED_6037 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amd04147]
    AMED_6037 (argH)
Enzymes [BR:amd01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     AMED_6037 (argH)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMED_6037 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 9440200
NCBI-ProteinID: YP_003768180
UniProt: A0A0H3DCL9
LinkDB All DBs
Position
complement(6691434..6692849)
Genome map
AA seq 471 aa AA seqDB search
MSGNEQPVQLWGGRFASGPAEAMAALSASTHFDWRLAPYDIAGSRAHARVLRKAGLLTDD
ELTGMLAALDTLAQDVASGAFTPTIADEDVHTALERGLLERAGTELGGKLRAGRSRNDQV
ATLFRMWLRDAARRVVAGTLEVIDALVSQAKRHPDAILPGRTHLQHAQPVLLAHHLMAHG
QALLRDVSRLQDWDARTAESPYGSGALAGSSLGLDPEAVAEELGFATSVENSIDGTASRD
FVAEFAFAVAMLAVNLSRIAEEVIIWNTAEFGYVTLDDAWATGSSIMPQKKNPDVAELTR
GKAGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSVEQLELLFPAIAGMLETLTFHT
DRLAELAPAGFTLATDIAEWLVRQGVPFRVAHEAAGESVRVAESRGAGLDELTDEEFEKI
NPALTPAVREVLTVEGSVKSRDARGGTAPVRVAEQRARIEERVTAARQWLN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggaacgagcagccggtgcagctgtggggcggccggttcgccagcggtccggcg
gaggcgatggccgcgctgagcgcgtcgacgcacttcgactggcgcctggcgccctacgac
atcgccggctcgcgggcgcacgctcgcgtgctgcgcaaggcgggcctgctcaccgacgac
gagctgaccggcatgctggccgccctggacacgctcgcccaggacgtcgcttcgggggcg
ttcaccccgacgatcgccgacgaggacgtgcacacggccctcgaacgcggcctgctcgag
cgcgcgggcaccgagctcggcggcaagctgcgcgccggccgctcgcgcaacgaccaggtg
gccacgctgttccggatgtggttgcgcgacgccgcccgccgggtcgtcgccggcaccctg
gaggtcatcgacgcgctggtgtcgcaggcgaagcggcatccggacgcgatcctgcccggc
cgcacgcacctgcagcacgcccagccggtgctgctcgcccaccacctgatggcccacggc
caggcgctcctgcgcgacgtctcgcggctgcaggactgggacgcccgcacggccgagtcg
ccgtacggctcgggagccctcgccggctcgtcgctgggtctcgaccccgaggccgtcgcc
gaggaactgggcttcgccaccagcgtcgaaaactccatcgacggcactgcttcgcgtgac
ttcgtcgccgagttcgccttcgccgtcgcgatgctcgcggtgaacctgtcccggatcgcc
gaagaggtgatcatctggaacaccgccgagttcggctacgtgaccttggacgacgcctgg
gccaccggcagctcgatcatgccgcagaagaagaacccggacgtcgcggagctcacgcgc
ggcaaggcgggccggctgatcggcaacctcaccggcctgctggccaccctcaaggcgcag
ccgctggcctacaaccgcgatctccaggaggacaaggagccggtgttcgactcggtcgag
cagctcgaactcctgttcccggcgatcgccggcatgctcgaaacgctcaccttccacacc
gaccggctcgctgagctggccccggccggcttcaccctggccaccgacatcgccgagtgg
ctggtgcgccagggcgttccgttccgcgtcgcgcacgaagcggcgggtgagagcgtccgc
gtcgccgagtcccgcggcgccggcctggacgagctgaccgacgaagagttcgagaagatc
aacccggcgctcacgcccgcggtgcgcgaagtcctgaccgtcgaaggctcggtgaagtcc
cgcgacgcccggggcggcacggcgccggtgcgggtggccgagcagcgcgcccggatcgag
gagcgtgtcaccgcggctcgccagtggctcaactga

DBGET integrated database retrieval system