KEGG   Amycolatopsis mediterranei U32: AMED_6002Help
Entry
AMED_6002         CDS       T01269                                 

Definition
(RefSeq) TrkA domain-containing protein
  KO
K07228  TrkA domain protein
Organism
amd  Amycolatopsis mediterranei U32
Brite
KEGG Orthology (KO) [BR:amd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AMED_6002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C LEP503
Motif
Other DBs
NCBI-GeneID: 9440162
NCBI-ProteinID: YP_003768145
UniProt: A0A0H3DCI8
LinkDB All DBs
Position
6651284..6651784
Genome map
AA seq 166 aa AA seqDB search
MGYRGLVNVEVTPLPGIGVRKDFATRTGRRIGVVTQRDGHIELIVSKSDDPDACAASIPL
TADEAGALANLLGAPQLVAQLTEEHRDLPGISTRQLPIKPSGPFDGRTLGDTAMRTRTGV
SVVAVARAGQVHPSPAPDFTFTGGDLLVAVGTGEGLEAAAKILKYG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgggttaccgtggtctggtgaacgtcgaagtgactcccctgcccggcatcggggtccgc
aaggacttcgccacccgtaccggccgccgcatcggcgtcgtcacccagcgggacggccac
atcgagctgatcgtgtccaaatcggacgatcccgatgcctgcgccgcctcgatcccgctc
accgcggacgaggccggcgcgctggccaacctgctcggcgcgccgcagctggtcgcgcag
ctgacggaggagcaccgggacctgccggggatcagcacgcggcagctgccgatcaagccg
tccggcccgttcgacggccggacgctcggcgacaccgcgatgcgcacccgcaccggcgtc
tcggtggtcgcggtggcgcgggccggccaggtgcacccgtcgccggcgccggacttcacc
ttcaccgggggcgacctgctggtcgcggtcggcacgggcgagggcctcgaagccgccgcc
aagatcctcaagtacggctga

DBGET integrated database retrieval system