KEGG   Amycolatopsis mediterranei U32: AMED_7645
Entry
AMED_7645         CDS       T01269                                 

Definition
(RefSeq) molybdopterin oxidoreductase family protein
Organism
amd  Amycolatopsis mediterranei U32
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Other DBs
NCBI-GeneID: 9441788
NCBI-ProteinID: YP_003769756
UniProt: A0A0H3DI60
LinkDB
Position
complement(8436670..8438988)
AA seq 772 aa
MGEWQRTACSLCYLNCGLEVQLDGRKITRVRGDKAHPRSGGYLCQKAQRLTFYGDHEDRL
TTPLRRRPDGTHEPIDWDTALTEIAAKLHAIRDADTAAGRPGSFAYVGGGGQGNHSGGAY
GTSLLKWMNSTRHFNALSQEKTGDFWVNGQLFGSTLVHTAEDVEHCDLLVVLGCNPWQAH
GFSNARQALNTLKNDPDRRMIVLDPRRTETAEMADLHLPLRPGTDAYLLGAILALLLERG
AADERFLADRTEGFDEVAAVLAKVPVDAWIAHAEVSRVDVERAVDLMCAAKAMTVRVELG
IQQGRHSTLNSYLEKLLYLLTGHFGRRGTNNLHSWLLPLWGTTTGQRSEITGFEYIGGLL
PANTLAEEVLADHPNRVRAVWVESSNPANTFAGTRDVERALEAAELSVVVDVAYTETAAL
ADYVLPAASQHEKWEFTLFTFEWPTNYFQLRRPLLDPLPGTLVEAEIYARLFDALGVLPP
SDVLASLAAGPRSELQAGLGALVQALPERAAILPVLLYRTLGASLPDGAASIAPLWAGCH
RAAKTMTVPVQRALGSSATGPRLGEELFERVLAGPTPFSAHEQDEVWSLMRRSRVRLAVP
ELLDWLAALDPAAERPDPAFPFSLVNGQRRAHNANQILRDPRWRRTDPDGALRARPEELA
SIGASPGDWVAVVTSAGRVVVRAEADPALRPGQLALPHGYGMAHPDADGRRVVSGPRINL
LTDALDRDPIAGTPHHKDVPARLEPATEEERARAEADSVRVRATVASGRTGR
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgggcgagtggcagcgcaccgcgtgcagcctctgctatctcaactgcgggctggaggtg
cagctcgacggccggaagatcacccgcgtccgcggcgacaaggcgcacccgcgttcgggc
gggtacctctgccagaaggcgcagcgcctgaccttctacggcgaccacgaagaccgcctg
acgacgccgctgcgccggcgtcccgacggcacgcacgagccgatcgattgggacacggcg
ctgaccgagatcgcggccaagctgcacgcgatccgggacgccgacaccgcggccgggcgg
cccggctcgttcgcctacgtcggcggcggtggccagggcaaccactccggcggcgcgtac
ggcacgtccctgctgaagtggatgaactcgacgcggcacttcaacgcgctgtcgcaggag
aagaccggcgacttctgggtcaacgggcagctgttcggctcgaccctcgtgcacaccgcc
gaggacgtcgagcactgcgacctgctcgtcgtgctcggctgcaacccctggcaggcgcac
gggttcagcaacgcccggcaggcgctcaacacgctcaagaacgacccggaccggcggatg
atcgtgctcgatccgcggcgcaccgagaccgcggagatggccgatctgcacctcccgctg
cgccccggcaccgacgcgtacctgctgggcgcgatcctggcgctgctgctcgagcggggc
gccgccgacgagcggttcctcgcggaccggaccgaagggttcgacgaggtcgccgccgtg
ctggcgaaagtgccggtggacgcgtggatcgcgcacgccgaagtgtcccgtgtggacgtc
gagcgggccgtcgacctgatgtgcgccgccaaagcgatgaccgtgcgcgtcgagctgggc
atccagcagggccggcactcgacgctcaacagctacctcgagaagctgctgtacctgctc
accgggcacttcggccggcgcggcacgaacaacctgcactcgtggctgctgccgctgtgg
ggtacgacgaccggacagcgctccgagatcaccggcttcgagtacatcggcggcctgctg
ccggcgaacaccctggccgaggaggtcctcgccgaccacccgaaccgcgtccgcgcggtg
tgggtggagtcgtcgaacccggccaacaccttcgccgggacgcgggacgtcgaacgcgct
ctggaggccgcggagctgtccgtggtcgtcgacgtcgcctacaccgagacggccgcgctg
gcggactacgtgctgcccgcggcgtcccagcacgagaagtgggagttcacgctcttcacc
ttcgagtggccgacgaactacttccagctgcgacggccgctgctggacccgctgccgggc
acgctcgtcgaggccgaaatctacgcgcggctcttcgacgcgctcggcgtgctgccgccg
tccgacgtgctcgcgtcgctggccgccgggccgcgctccgagctgcaggcgggcctcggc
gccctggtccaggcgctgccggagcgcgcggcgatcctgccggtgctgctctaccgcacc
ctgggcgcgtcgctgcccgacggcgcggcgtcgatcgcgccgctgtgggcgggctgccac
cgcgcggcgaagacgatgaccgtgccggtgcaacgcgcgctgggcagctcggccaccggt
ccgcggctcggggaggaactcttcgagcgggtcttggccggtccgacgccgttttcggcg
cacgagcaagacgaagtgtggagcctgatgcgccgctcgcgggtccggctggcggtaccg
gagctgctggactggctggccgcgctggacccggccgccgaacggcccgacccggcgttc
ccgttttcgctggtcaacgggcagcggcgggcgcacaacgcgaaccagatcctgcgtgac
ccgcgctggcgccgcaccgatccggacggcgctctgcgcgcgcgtcccgaagaactggcg
tcgatcggcgcttccccgggtgactgggtggccgtcgtgacctcggcgggccgcgtggtc
gtccgcgccgaggccgaccccgcgctgcggccgggccagctcgcgttgccgcacggctac
ggcatggcccacccggacgccgacggccgccgcgtggtcagcggcccgcggatcaacctc
ctgacggacgcgctggatcgtgacccgatcgcgggcaccccgcaccacaaggacgtcccg
gcgcgcctggaacccgcgaccgaagaggagcgggcgcgggcggaggcggacagcgtgcgc
gtccgcgcgaccgtcgcgagtggacggaccggccgctag

DBGET integrated database retrieval system