KEGG   Amycolatopsis mediterranei U32: AMED_7738Help
Entry
AMED_7738         CDS       T01269                                 

Gene name
metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00270  Cysteine and methionine metabolism
amd00450  Selenocompound metabolism
amd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AMED_7738 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMED_7738 (metB)
Enzymes [BR:amd01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AMED_7738 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 9441881
NCBI-ProteinID: YP_003769848
UniProt: A0A0H3DFG5
LinkDB All DBs
Position
complement(8519938..8521056)
Genome map
AA seq 372 aa AA seqDB search
MTSSLRTRAVHAGRDDLTDLGVHAAPLDLSTTYPSRDSAAEAARIDAFAAGAELDGPPIY
GRVGNPTVERFERALAELEGFDHGVAFASGMAAVSACLLSAVAQGKRHVVAVRPLYGCSD
HLLESGLLGTEVTWAAPGAVTAALRPDTGLVFVETPANPTLAEADIAELARACGDVPLLV
DNTFATPVLQRPGRHGARLVLHSATKFLGGHGDVMGGIVACDAPEAARLRQIRFATGGVL
HPLAGYLLLRGLSTLPLRVNAASATAATLASRLREHPAVTAVHYPRIGGPLVAFEVGGDP
HALIAAVRLITPAVSLGSVDTLIQHPGSISHRIVDEGDRQSAGVSDQLIRMSVGLEDVED
LWADLEQALKVG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctcgctgcgcacgcgggccgtccacgccggccgtgacgatctcacggacctc
ggcgtgcacgccgctccgctcgacctgtccacgacctacccgtcccgcgacagtgccgcc
gaagccgcccggatcgacgccttcgccgccggcgccgagctcgacggcccgccgatctac
gggcgggtgggcaacccgaccgtcgaacggttcgagcgcgcgctcgccgagctcgaaggc
ttcgaccacggcgtcgcgttcgccagcggcatggccgccgtctcggcctgcctgctttcc
gcggtggcgcaagggaaacggcacgtcgtcgcggtgcgcccgctctacggctgcagtgac
cacctgctcgagtccgggctgctcggcacggaggtcacctgggccgcacccggcgccgtc
accgccgcgctgcggccggacaccgggctggtgttcgtcgagacgccggcgaacccgacc
ctggccgaggcggacatcgccgagctggcccgtgcttgtggcgacgtgcctctcctggtg
gacaacacgttcgccaccccggtcctgcagcgccccggccgccacggcgcccggctggtg
ctgcacagcgcgacgaagttcctcggcggccacggcgacgtgatgggcgggatcgtcgcg
tgcgacgcgccggaagccgcccggctgcgccagatccgcttcgccaccggcggcgtgctg
cacccgctcgccggatacctgttgctgcgcgggctttccacgctgccgctgcgcgtcaac
gccgcctccgcgaccgcggcgacgctggcgtcacggctccgcgagcacccggccgtgacc
gccgtccactacccgcggatcggcggcccgctggtggcgttcgaggtcggcggcgacccg
cacgccctgatcgcggcggtccggctgatcacgccggccgtcagcctcggcagcgtcgac
acgctgatccagcacccgggctcgatcagccaccggatcgtcgacgagggcgaccgccaa
agcgccggcgtgtccgaccagctgatccggatgtccgtcggtttggaggacgtcgaggat
ctgtgggccgatctggagcaggcgctgaaggtcggctga

DBGET integrated database retrieval system