KEGG   Amycolatopsis mediterranei U32: AMED_7878Help
Entry
AMED_7878         CDS       T01269                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00410  beta-Alanine metabolism
amd00640  Propanoate metabolism
amd00650  Butanoate metabolism
amd01100  Metabolic pathways
amd01120  Microbial metabolism in diverse environments
Module
amd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_7878 (gabT)
   00650 Butanoate metabolism
    AMED_7878 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_7878 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_7878 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amd01007]
    AMED_7878 (gabT)
Enzymes [BR:amd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMED_7878 (gabT)
Amino acid related enzymes [BR:amd01007]
 Aminotransferase (transaminase)
  Class III
   AMED_7878 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 GGN
Motif
Other DBs
NCBI-GeneID: 9442020
NCBI-ProteinID: YP_003769986
UniProt: A0A0H3DIS7
LinkDB All DBs
Position
8667095..8668351
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVVVDHGEGVYLYDLEGKRHLDFTAGIGVTSTGHCHPHVVRAAQEQIG
KLVHGQYTTVMHKPLLELTERLGEVLPGGLDSLFYANSGSEAVEAALRLSRQATNRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGIGPLMTGVHVAPFPYAYHYGWDEQTATKFALREL
DYLFQTVCAPNETAAFFVEPVLGEGGYVPANTEFLAGLRERADRHGILLVVDEIQTGFGR
TGKFWGHDHFDVSPDIVLIAKGLASGFPLSGIAASQELMAKAFPGSQGGTYGGNAVSCAA
AIATLEVIQQENLVENAAERGRQLLEGARVIADKTPSIGEVRGLGLLVGSEFSTADGEPD
TPTAQAAQQAAAKSGLLLLTCGPYMNVVRMVPPLVVTAEQVDDALRIWGDVVASVTGS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagctctctccgctgctcaagcaggcaacgcccgtcgtggtcgaccacggtgaa
ggggtttacctctatgacctcgagggcaaacgccacctcgacttcaccgccggtatcggc
gtcacgagcaccgggcactgccacccccacgtggtgcgggccgcgcaggagcagatcggc
aagctcgtccacggccagtacacgacggtcatgcacaagccgctcctcgaactcaccgag
cgcctcggcgaggtcctgcccggcgggctcgactcactcttctacgcgaactcgggcagc
gaagccgtcgaagcggcgttgcggctttcgcggcaggcgacgaaccgcccgaacgtcatc
gtcttccagggtggcttccacggccggacggtcgccgccgcgaccatgacgacgtccggg
acgcggttcagcgccggcatcggcccgctgatgaccggcgtgcacgtcgcgccgttcccg
tacgcctaccactacggctgggacgagcagacggcgacgaagttcgcgctgcgcgagctg
gactacctcttccagaccgtctgcgcgccgaacgagaccgccgcgttcttcgtcgaaccc
gtgctgggcgagggcgggtacgtcccggcgaacaccgagttcctggccggcctgcgcgag
cgcgccgaccggcacggcatcctgctcgtcgtcgacgagatccagaccggcttcggccgc
accgggaagttctggggccacgaccacttcgacgtctcccccgacatcgtcctcatcgcg
aagggcctggccagcggcttccccctgtccggcatcgccgcttcgcaggagctgatggcg
aaggcgttccccggctcgcagggcgggacgtacggcggcaacgcggtttcgtgcgccgcg
gcgatcgcgacgctcgaggtcatccagcaggagaacctggtcgagaacgccgccgagcgc
gggcgccagctgctcgaaggcgcgcgggtgatcgcggacaagacgccgtcgatcggcgaa
gtgcgcgggctcgggctgctggtcggctcggagttcagcaccgccgacggcgaaccggac
acgcccaccgcgcaggccgcccagcaggcggcggcgaagagcgggctgctgctgctcacc
tgcgggccgtacatgaacgtcgtccggatggtgccgccgctggtcgtcaccgccgagcag
gtcgacgacgcgctgcggatctggggcgacgtcgtcgcctcggtcacggggagctga

DBGET integrated database retrieval system