KEGG   Amycolatopsis mediterranei U32: AMED_7939Help
Entry
AMED_7939         CDS       T01269                                 

Gene name
ald
Definition
(RefSeq) alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00430  Taurine and hypotaurine metabolism
amd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_7939 (ald)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AMED_7939 (ald)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     AMED_7939 (ald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N Pyr_redox Pyr_redox_2 2-Hacid_dh_C HI0933_like GIDA NAD_binding_2 F420_oxidored Shikimate_DH NAD_binding_7 3HCDH_N NAS NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 9442080
NCBI-ProteinID: YP_003770046
UniProt: Q8RME8 A0A0H3DIY9
LinkDB All DBs
Position
8735637..8736752
Genome map
AA seq 371 aa AA seqDB search
MRIAVPREIKKHEYRVALTPAGVHELAGRGHDVFVETGAGVGSSITDEEYVAAGAKILTT
ADETWAEGELILKVKEPVAEEYGRLRRDQVLFTYLHIAADRPLTDALLAAGTTAIAYETV
QTANGALPLLAPMSEVAGRLAPQVGAFSLMKPSGGRGVLPGGIPGVHPARVVVIGGGVAG
LNAARVALGLGSDVEILDTNVDRLRQIDNDFGGRIRTVTSTRFSVEEAVLQADLVIGAVL
VPGAKAPKLVSNDLVARMKPGSVLVDIAIDQGGCFADSHPTTHDDPTYTVHESVFYCVAN
MPGAVPRTSTYGLTNVTLPYAVQLAEHGWKAALQADAALAKGLNTHDGALTNGPVAVAHD
LPHTPLDTVLA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcgccgttccccgtgagatcaagaagcacgaatatcgggtcgcgctgaccccg
gccggggtgcacgagctggccggccgggggcacgacgtcttcgtcgagaccggcgccggg
gtgggttcgtccatcaccgacgaggagtacgtcgccgccggcgcgaagatcctcaccacc
gccgacgagacctgggccgagggcgagctcatcctcaaggtcaaggaacccgtcgccgag
gagtacgggcggctccggcgcgaccaggtcctgttcacctacctccacatcgccgccgac
cggccgctgaccgacgcgctgctggcggccggcaccaccgccatcgcctacgagacggtg
cagaccgccaacggtgcgctcccgctgctcgccccgatgtccgaggtcgcgggccggctg
gccccgcaggtcggcgcgttctccctgatgaagcccagcggcggccgcggtgtgctgccc
ggcggcatccccggcgtgcacccggcgcgcgtcgtcgtcatcggcggcggcgtcgcgggc
ctcaacgccgcccgggtcgcgctcggcctcggctcggacgtcgagatcctcgacacgaac
gtcgaccgcctccgccagatcgacaacgacttcggcggccgcatccgcacggtgacgtcg
acccggttctcggtcgaggaggccgtgctgcaggccgacctggtcatcggcgcggtgctc
gtccccggcgcgaaggcgccgaagctggtctcgaacgacctggtggcccgcatgaagccg
ggcagcgtgctcgtcgacatcgcgatcgaccagggcggctgcttcgccgactcgcacccg
accacgcacgacgacccgacctacaccgtgcacgagtccgtcttctactgcgtcgcgaac
atgccgggcgcggtgccccggacgtcgacctacggcctcacgaacgtcaccctgccctac
gcggtccagctggccgagcacggctggaaggccgcgctgcaggccgacgccgccctcgcg
aagggcctcaacacacacgacggcgccctgacgaacggcccggtcgcggtggcccacgac
ctgccgcacacgccgctggacaccgtcctcgcctga

DBGET integrated database retrieval system