KEGG   Amycolatopsis mediterranei U32: AMED_8869Help
Entry
AMED_8869         CDS       T01269                                 

Gene name
gadB
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00250  Alanine, aspartate and glutamate metabolism
amd00410  beta-Alanine metabolism
amd00430  Taurine and hypotaurine metabolism
amd00650  Butanoate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd02024  Quorum sensing
Module
amd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMED_8869 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_8869 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_8869 (gadB)
   00430 Taurine and hypotaurine metabolism
    AMED_8869 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AMED_8869 (gadB)
Enzymes [BR:amd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AMED_8869 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 9443004
NCBI-ProteinID: YP_003770962
UniProt: A0A0H3DI34
LinkDB All DBs
Position
complement(9721483..9722871)
Genome map
AA seq 462 aa AA seqDB search
MVLHQGKAGRPDRTAGTNPLYAGANPALAAGFVMPHDKLREDSLPPDTALQLVRDELMLD
GNARLNLATFVTTWMEPQARELMAECVDKNMIDKDEYPQTAELERRCVNILADLWHAPDP
GDVMGCSTTGSSEACMLAGMALKRRWSKLGRTGKPNLVMGANVQVCWEKFCEYWEVEPRL
VPMDGDRYHLTADEAVARCDENTIGVVAILGSTFDGSYEPVAEIAAALDSLEERTGWDIP
VHVDGASGAMIAPFLDPHLEWDFRLPRVASINTSGHKYGLVYPGVGWVLWRDKAALPSEL
VFNVNYLGGDMPTFALNFSRPGAEVAAQYYTFVRLGREGFRAVQQASRDVALHLSSGIAS
LGPFSLLTRGDQLPVFAFTTRPDVGFDVFDVSRRLRERGWLVPAYTFPENRTDLAVLRIV
VRNGFTHDLADLLLADLRRVLPELEQFGGRPKDPAKATAFHH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcatcaggggaaagccggccgcccggaccgcacggcggggacgaacccgctc
tacgccggagcgaatccggcgctcgcggcgggcttcgtcatgccgcacgacaagctgcgt
gaggactcgctgccgccggacaccgcgctgcagctcgtgcgcgacgagctgatgctcgac
ggcaacgcgcggctcaacctcgccaccttcgtcacgacgtggatggagccgcaggcgcgt
gagctgatggccgagtgcgtcgacaagaacatgatcgacaaggacgagtacccgcagacg
gccgagctcgagcggcgctgcgtgaacatcctggccgacctgtggcacgcgcccgacccg
ggcgacgtcatgggctgctcgacgaccgggtcgtcggaagcgtgcatgctcgccgggatg
gcgctgaagcggcgctggtccaagctcgggcgcaccgggaagccgaacctggtgatgggc
gcgaacgtccaggtgtgctgggagaagttctgcgagtactgggaagtcgagccgcggctg
gtcccgatggacggcgaccgctaccacctcaccgccgacgaagccgtggcgcgctgcgac
gagaacaccatcggcgtggtggcgatcctgggctcgacgttcgacggcagttacgagccg
gtcgcggagatcgccgcggccctggactcgctggaagagcgcaccggctgggacatcccg
gtgcacgtcgacggcgcttcgggcgcgatgatcgccccgttcctcgacccgcacctggag
tgggacttccgcctgccgcgcgtggcgtcgatcaacacgtcgggccacaagtacgggctg
gtgtacccgggcgtcggctgggtgctctggcgcgacaaggccgcgctgccgtccgagctg
gtgttcaacgtgaactacctcggcggcgacatgccgacgttcgcgttgaacttctcccgc
ccgggcgccgaggtcgcggcccagtactacacgttcgtccggctcggccgggaagggttc
cgcgcggtgcagcaggcttcgcgtgacgtcgccctgcacttgtcgtccgggatcgcgtcg
ctggggccgttctccttgctgacccgaggtgatcagctgccggtgttcgcgttcaccacc
cgcccggacgtcggcttcgacgtcttcgacgtgtcccgccgactgcgtgagcgcgggtgg
ctggtcccggcgtacacgttccccgagaaccggacggacctggcggtgctgcggatcgtg
gtccgcaacggcttcacacacgacctggcggatctgctgctggcggatttgcggcgggtg
ctcccggagctggagcagttcggcggccgcccgaaggacccggcgaaggcgaccgcgttc
caccactag

DBGET integrated database retrieval system