KEGG   Apis mellifera (honey bee): 408328Help
Entry
408328            CDS       T01057                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ame03012]
    408328
   03029 Mitochondrial biogenesis [BR:ame03029]
    408328
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    408328
Translation factors [BR:ame03012]
 Eukaryotic Type
  Elongation factors
   408328
 Prokaryotic Type
   408328
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    408328
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   408328
  Exosomal proteins of breast cancer cells
   408328
  Exosomal proteins of colorectal cancer cells
   408328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 408328
NCBI-ProteinID: XP_391880
BEEBASE: GB43088
UniProt: A0A087ZW54
LinkDB All DBs
AA seq 469 aa AA seqDB search
MALRCTKIICDSGFRYTIKQPFLVEYFVKQFYGQSRAGTYLSGVITQKFYSTKKVFNRTK
PHCNVGTIGHVDHGKTTLTAAITKVLAEKELAEAKDYADIDNAPEEKERGITINVAHVEY
QTEKRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGTMPQTREHLLLAKQIGIQH
IVTFINKVDVADEEMVDLVEMELRELLSEMGYDGDNIPFIKGSALCALNNSNPKIGHDSI
LKLLEAVDDYIPTPIRDLDKPFLLPIENVYTISGRGTVVTGRLERGKIKKGMDCELLGFN
KMIKSTITGIEMFHQTLEEAEAGDQMGALLRGLKRDEVRRGMVLCKPGTMKANDHLECQV
YMLTSAEGGKRKPINNLVQIQMFCKTWDCASQLNLVDKTLVMPGEDSTIRLKLIRPMVCE
KGQRFTLRDGKVTIATGVITNILPKLNEHERLEILEGKKKGLKKEMAKA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaggtgtacaaaaattatttgcgattctggttttcgatatacaataaagcaa
ccatttctagttgaatattttgttaaacagttttatggacaatcacgtgcagggacttat
ttgtcgggtgtgataacgcaaaaattttatagcacgaaaaaagtatttaacagaactaaa
ccgcactgtaatgtcggtactatcggacatgtggatcatggaaaaacgacacttacagca
gctattactaaagttcttgccgagaaagagttggcagaagcgaaagactatgccgatatc
gataatgcacctgaagaaaaagaacgtggtataactatcaatgtcgctcacgttgaatat
cagacggagaaacgtcattacggtcataccgattgtcctggacacgcggattatattaaa
aacatgattactggtacggcacaaatggatggggctattctcgttgttgccgctactgat
ggtactatgccgcaaacgagagaacatcttttgcttgccaagcagatcggtatccaacat
attgtcacatttattaataaggttgatgtcgctgatgaagaaatggtggatttagtagag
atggaattaagggagctattaagcgaaatgggttatgatggagataatataccctttatt
aaaggaagtgccctttgcgcgttaaataattctaatccaaaaataggacatgattctata
ttaaagttgttagaagctgtggatgactatattcctactcctatcagagatttggacaaa
ccctttttgttaccgatagaaaatgtttacacgatttcgggtagaggaacagtagtcaca
ggtagattggaacgtggaaaaataaaaaagggtatggattgtgaattgcttgggtttaat
aaaatgataaagagcacgataacgggaatagaaatgtttcatcaaacgttggaagaggct
gaagcaggagatcaaatgggtgctttgcttagaggtttgaaaagagacgaggttagaaga
gggatggtattgtgtaaaccaggcactatgaaagctaatgatcatttggaatgtcaagta
tatatgttgactagtgcggaaggaggtaaaagaaaacctatcaataatcttgtgcaaatt
caaatgttttgcaaaacatgggattgtgcaagtcaattaaatttggtagataagactttg
gtcatgcctggtgaagattctaccattagattaaaattaataagaccaatggtgtgcgaa
aaaggacaacgatttactttaagagatggaaaggtaactatagcaactggagtaattacg
aatattttaccaaagctgaacgaacatgaacgactggaaattctcgaaggtaaaaagaaa
ggattgaaaaaagaaatggcaaaagcttaa

DBGET integrated database retrieval system