KEGG   Apis mellifera (honey bee): 409365Help
Entry
409365            CDS       T01057                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00052  Galactose metabolism
ame00500  Starch and sucrose metabolism
ame01100  Metabolic pathways
ame04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    409365
   00500 Starch and sucrose metabolism
    409365
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    409365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    409365
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     409365
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   409365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 409365
NCBI-ProteinID: XP_392880
BEEBASE: GB53384
LinkDB All DBs
AA seq 976 aa AA seqDB search
MDVKDTRQFLRKNMILNRYCRYISTHFLKLIVFLILFGFIIVSIKQSGCITIKKYEINII
FNKTLQKDNMNYKSINVSTILSKNKNFKHDIVFDNKTSQFSKIVQEQCDNIPVTLRFDCH
PEDGATKLSCANRGCCWNSFEKQIPTIKQASLNIPYCYYPSNWSIYKYENFTIDGNNFSG
FLKQMKRSFYENDIPSVKVETSAIDNSILRIKIYDAFKKRYEPPWPLRSDPKPFIQKNNY
AKYKLNVDNIKPGFKVYRTLDDTIIFDSINIGGFIFAEQFLQISALLPSHNIYGIGEHET
KLKLNTNWQSFTLFNKDQPPIENANLYGSHPFYLIIENSGNSHGVLFLNSNAMDVILQPS
PAITFRAIGGIFDIYFFLGPTPADVIKQYSEIVGKPFLPPYWSLGFHLCRYGYGSLEKTK
EVWNRTIAAGIPFDTQWNDLDYMDKNNDFTYNSDRFKDLPQFVNEIHSRGMHYIPLIDAG
VSGSEKNGTYLPYDEGLKEDIFIKDEKGDQPFVGKVWNLISTVWPDFTNPKARNYYFRMM
NDMHNNFAYDGAWIDMNEPSNFYNGHKYGCSQNKLDYPKYIPRVIGNILSTKTLCMNAKH
YLGFHYDLHNTYGTSQAIATNYALTNIRRKRPFIISRSTWVGHGYYAGHWTGDVYSSWHD
LKMSIPAILLMNFYQIPMVGADICGFNGNTTTSLCNRWMQLGAFYPFSRNHNSDDTIEQD
PVAMGDLVIKSSKRALTIRYWLLPYLYTLFFRAHKFGETVARPLFFEFPNDSITYDIDAQ
YLWGNSLMIIPVLEENKTEVIAYLPRGLWYNFYTKDSLFALGKYYTLNAPLDVIPLMIRG
GSILPAQKPADTTTASRKNNFELLITLDNVKKAKGELYWDDGDSLDSFEKRQFVWTFFNI
ENNTLSNSKAMKSYFDEKIILDKIQIWGITSNISKVFLNDHEIRFEYIKKENCLNINNLR
VDLRENFSLSWRYDEF
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaaagatacacgacaatttttaagaaaaaatatgattttaaatagatattgt
agatatatatcgacacattttctgaaattgatcgtatttcttattctatttggttttata
atagtttctataaaacaaagtggatgcattactataaagaaatatgaaataaatataatt
tttaataaaactttacaaaaggacaatatgaattataaatcgatcaatgtttctacaata
ttatctaaaaataaaaatttcaaacatgatatagtatttgataataaaacatctcagttt
tctaaaattgtacaagaacaatgcgacaatattccagttacattacgttttgattgtcat
ccagaagatggagcaacaaaattatcttgtgcgaatagaggttgttgttggaattctttc
gaaaaacaaattccaaccataaaacaagcctctctaaatatcccatattgttattatccg
agcaattggagcatatataaatatgaaaattttactatagatggaaataatttttctgga
tttctcaaacaaatgaaaagatcattctatgaaaatgatataccatctgttaaggtagaa
acaagcgctatagataattctattttacgtataaaaatatacgatgcttttaagaaacgt
tatgaaccaccatggcctctgagatcggatcctaaaccatttattcaaaaaaataattat
gcaaaatacaaattaaatgttgataatattaaacctggttttaaagtatacagaacttta
gatgatacaataatatttgattctattaatatcggaggttttatatttgctgagcaattt
ttgcaaataagcgctcttttaccaagtcataatatttatggtattggagaacatgaaaca
aaattgaaattaaatactaattggcaatcttttacattatttaacaaagatcaaccaccg
atcgaaaatgcaaatttatatggatcgcatcccttttatttaataattgaaaattcagga
aattctcatggagttctatttcttaatagtaatgctatggatgtgatattacaaccatca
cctgctattacctttcgagctattggcggtatttttgatatatatttttttttgggtcca
actccagcagatgtcataaaacaatattctgagatagtaggtaaaccatttctgccccca
tattggtcccttggttttcatttatgcagatacggatatggaagtttagaaaagacaaaa
gaagtatggaatagaactatagcagcaggaattccatttgatactcaatggaacgattta
gattacatggataagaataacgattttacatataattcagacaggtttaaggatttacca
caatttgttaatgaaatacattcgagaggaatgcattatattccgttgattgatgcagga
gtatctggttctgaaaagaacggaacttatttgccgtacgatgaaggtttgaaagaagat
atatttataaaagatgaaaaaggtgatcaaccatttgttggcaaagtttggaatctaatt
tctactgtgtggcctgattttacaaatcccaaagcgcgaaattattattttcgtatgatg
aatgatatgcataataattttgcatatgatggtgcttggatagacatgaacgagccttct
aacttttataatggacataaatatggatgttcacaaaataaattggattatcctaaatat
ataccgcgtgttattggcaatattctatcaacgaaaacattgtgcatgaatgctaaacat
tatttgggctttcattacgatcttcacaatacttatggcacaagtcaagcgatagcaact
aattatgcattaaccaatattagacgaaaaagaccatttataatatcacgttcaacctgg
gtaggacatggttactatgctggtcattggacaggagatgtttattcctcgtggcatgat
ttaaaaatgagcattccagcaattttgttgatgaacttttatcaaataccaatggttggt
gctgacatttgtggattcaatggaaatactacaacaagtttatgcaatcgttggatgcaa
cttggtgcattttatcctttttctcgtaatcataattcagatgatacaattgaacaagat
ccagttgctatgggcgatttggtaataaaatcatccaaacgtgcccttacgatacgttat
tggttgttaccgtatttgtatacgttattttttcgggcacataaatttggagaaactgta
gcgaggccattatttttcgaatttcctaacgattcgatcacatatgatatcgatgctcaa
tatctgtggggcaattctttgatgataatcccagttttagaagaaaacaagacagaagta
attgcttatttgccacgtggattatggtataatttttatacaaaagattctcttttcgcg
ctcggcaaatattacacattgaatgcaccactcgatgtcataccattaatgattcgcgga
ggatctattttgccagcacaaaaaccagccgatactacaacagctagcagaaaaaataat
tttgaattattgattacattggataatgtaaaaaaggcaaaaggagaattatattgggat
gatggtgatagtttagattcgttcgagaagagacaatttgtatggacatttttcaatatt
gagaataatactttatctaattccaaagcaatgaagagttatttcgatgagaagattatt
ttagataaaatacaaatatggggaataacatctaatatttcaaaagtttttttaaacgat
cacgaaatacgattcgaatatatcaagaaggaaaattgcttaaatataaataatttacga
gtggatttgagagaaaatttttcgctttcttggagatatgatgaattttga

DBGET integrated database retrieval system