KEGG   Apis mellifera (honey bee): 411257Help
Entry
411257            CDS       T01057                                 

Gene name
Hbg2
Definition
(RefSeq) alpha-glucosidase precursor
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00052  Galactose metabolism
ame00500  Starch and sucrose metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    411257 (Hbg2)
   00500 Starch and sucrose metabolism
    411257 (Hbg2)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     411257 (Hbg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-GeneID: 411257
NCBI-ProteinID: NP_001035349
BEEBASE: GB54549
UniProt: Q25BT7
LinkDB All DBs
AA seq 580 aa AA seqDB search
MFRATIVTVACLLLAASPIDCVDANWYKNALVYQIYPRSFQDSDGDGIGDLNGITARMDH
IADIGADALWLSPIYKSPQVDFGYDISNFTDVDPVYGTLADFDRLVRRAKSLGLKVILDF
VPNHSSHEHPWFKKSVQRIKPYDEYYVWRDARIVNGTRQPPNNWLSVFWGSAWQWNEERK
QYYLHQFATGQPDLNYRSAALDQEMKNVLTFWMNRGVDGFRIDAINHMFEDARLLDEPSA
NRTDLSKDDYESLVHLYTRDQSETYDVLRSWRNLMDEHSNRTNSDPRMILTEAYTEFNLT
IKYYKSGSTVPFNFMFIADLNNQSTASDFKQLIDRWVANVPNGSVTNWVSGNHDNHRVAS
RFGRQRGDEIVMLTLTLPGIGVVYNGDEIGMEDRWFTYQETVDPAGCNAGPAKYYLKSRD
PERTPYQWDNSTSAGFSQTNKTWLPVNENYKSLNLAAQKREYYSHYVAFKSLSYLKKQPV
IANGSLEVDVIDGRVLSVKRELGNDTVIVMMNFSKNPVTVNLTKLHPPADLVVYACNVVG
SGLSHGNWIYPASMTIPGSNSAVFTNYKLYWRYWQGVDWL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgagcgacgatagttacggtcgcttgcctcttgctcgccgcgtctccgatcgat
tgcgtggacgccaactggtacaaaaatgctctcgtgtaccaaatctatccgaggagtttc
caagacagcgacggggacggtataggcgatttgaacgggatcacggcccggatggatcac
atagccgacataggggcggacgctctctggttgtcgcccatctacaagagtccccaggtc
gatttcggctacgacatctccaacttcacggacgtggacccggtttacggcactctggca
gatttcgacaggctcgtgagaagggcgaaatctctcggtttgaaggtgatactcgacttc
gtgcccaatcacagttcccacgagcatccgtggttcaagaagagcgtccaaaggatcaaa
ccgtacgacgagtactacgtgtggcgggacgcgaggatcgtgaacgggaccaggcaaccg
cccaacaattggctcagcgtcttctggggttcggcgtggcaatggaacgaggaacgaaaa
cagtactatcttcaccagttcgcgaccggccaaccggatctgaattacaggagcgccgcg
ttggatcaggagatgaagaacgtgttgacgttctggatgaacaggggggtggacggtttc
cggatcgacgccatcaaccacatgttcgaggacgcgaggctgttggacgagccgagcgcc
aacaggaccgacctgtccaaggacgattacgaaagcttggtccacttgtacacgagggat
caaagcgagacgtacgacgtgttgagaagttggagaaacctcatggacgagcactcgaat
cgcaccaactccgacccgaggatgatcctcaccgaagcgtatacggagttcaatttgacg
atcaagtattacaagtccggatccacggtcccgttcaactttatgttcatcgcggatctc
aacaaccagtcgaccgcctcggacttcaaacagctgatcgacagatgggtggcgaacgtg
ccgaatgggagcgttaccaattgggtctcgggcaatcacgacaatcaccgcgtcgcctcg
agattcggcaggcaaaggggcgacgagatcgtgatgctgacgttgactttgcccggcata
ggggttgtttacaatggggacgagatcgggatggaggacaggtggttcacgtatcaggag
accgtagacccggccggttgcaacgccggccccgccaaatattacttgaaatccagggat
ccagagaggactccgtatcaatgggacaacagcacgagcgccggattctcccaaacgaac
aaaacttggctacccgtcaacgaaaattacaagtctttgaatcttgccgctcaaaagagg
gaatattattcccattacgtggcgttcaagtccttgtcgtatctgaagaagcagccggtg
atcgctaatgggagcttggaggtggacgtgatcgatggaagggttctgagcgtgaaacgg
gaattgggtaacgacaccgtcatagttatgatgaatttctccaaaaaccccgtcactgtc
aacctcaccaagctgcatccacctgccgatctcgtcgtttacgcttgcaacgttgtcggc
tccggtctcagccacggcaactggatctatccggcctcgatgactatccccggatctaac
tcagccgtattcaccaattacaaattgtattggcgatattggcaaggtgtagactggttg
taa

DBGET integrated database retrieval system