KEGG   Apis mellifera (honey bee): 412055
Entry
412055            CDS       T01057                                 

Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ame01002]
    412055
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ame03110]
    412055
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     412055
Peptidases and inhibitors [BR:ame01002]
 Serine peptidases
  Family S8: subtilisin family
   412055
Chaperones and folding catalysts [BR:ame03110]
 Intramolecular chaperones
  Subtilisin family
   412055
SSDB
Motif
Pfam: Glyco_transf_64 TPPII Peptidase_S8 Exostosin TPPII_N Crescentin SR-25
Other DBs
NCBI-GeneID: 412055
NCBI-ProteinID: XP_006564519
BEEBASE: GB54269
LinkDB
AA seq 2259 aa
MAEVIDCNFPVWGLLPKKETGVTQFLTKYPEYDGRGVIIAIFDSGIDPGAPGMQETSDGK
PKIIERYDCSGAGDVDTSKIVQAPDGYIIGITGRKLKVPSNWVNPSGQYHIGIKNLYSLY
PGKLRERVLVERKKRLWDNNHKSALAEASRQLQEFEAKNPQLTTLKERLEKEELEARVEI
LNNIEKKYSDVGPTYDCVVFHDGEVWRACIDTSEEGNLETGVFLGEYTITRQYAPLIPED
QLNISINIHDDGNTLEIVSLCSSHGTHVASIAAAYFPDNPELNGVAPGAQIISLSVGDGR
IGTMETGTAVVRAMIHVMKHKEKIHVINMSYGEHAHWSNTGRIGELMNEVIDKYGVTWVA
SAGNLGPALCTIGTPPDISSNSVISVGAYVSPDMMVAEYSLREKMPGMSYTWSSRGPMID
GGAGITVCAPGGAITSVPNFTLRKSQLMNGTSMAAPHVTGAIAILISGLVAKGCSYSPYS
IKRALENTAHYIQNLDPFAQGSGLLQVERAFDNLITYCDVPERDVRFTINCGPNNAKGIH
MRSSIIDRPKDYAITVEPVFLNSENTDPTLKIAFNLKLTLVCDASWVHFPTHLDLMNMVR
AFAIKVDGFNLPEGVHTTSVRAYDVTDVAKGPVFQIPVTVVQPQTLPKTAILPDLTYTNI
LFKPNTIYRHFILVPEDATWAVIRLKSTEKDKTGRFVIHSVQLKPRLSCKTLEVNKLFTV
TSQSEIVHPFAVQGGLILELVIAKYWANIGDMLVDYVIEFHGVRMISGNLTMQSGDGINR
LEVRSSLRNEEVVPSICLKSSVQILKPTDSRIAPLRERDIIPPSRQIYELQLTYTFHCAK
VTEITPNAALLSDLLYESEYESQMWMIYDSNKQLICCGDAYPSKYSNQKIEKGDYTLKIH
IRHEKKDLLDRLTEMPFLLSHKLSNPINLDVYASQSQAIIGGKKMIAASVPPGHILPLYI
APISNENKVSRGITLGSGSYLQGTLTFCKDDNGKKVDCHTFKYILSEPNKKSSSSSSSSS
SSSSYSSSNKEKPTKWDEYNEALRDFKCSWLTKLEPGEYANLLYGELKNLFSDHLPVHTA
MLISLDSPEARRHVPHDDISEESVSLANQIISVADAVITNIDQDKLLAYYGLKSDQRDDA
TKIRATMEKQKFSLIKALVKKGCALSRLYVHSAKKGEGDRQSYEHLLDSVTHHWQEVQKF
AEPTDIKVISLSLWHAHINNHYGRYLKLLLRYYEEHPLKEVDEKCIELANILGWEHLSRH
INTISEACTLICLLVAQRISQTGLLIYNIEKSPQFIAIIAEAMIEGNNIHAWIVKKGLVS
HPYLSTEEALKLGGRNLNLLREWVTFFDSHSHSTIVNPNRGLVIAQVESDSPDKDIYRTF
STLEAFEDFTPMKASQLKMRIEEMLRIKVSVNNELRDLSAKRQRLQVEVSSLTQKIDELK
QELLHQQTDLDRLKISVEQAQVAQREAVERNTPELAPPKRILMNSVPVVLPNTVPHSCRM
YNCFDHSRCALTSGFPVYLYDPDQYSVVNSGWDVDGFLKTTIKQTLGYNPHLTTNAAEAC
IYIVLIGEALSIQQKVDKKFRKPIDVKKLHALPYWGGDGRNHILLNLARRDLSVESGDIF
SGIDTGRAIIVQSTFFRNQFREGFDLVVPPILGPPGGDVWQECAQMLPARRKYLLSFQGE
MRSPKITTMTHQIDDADVDIEKLTIDENNLDAFIIQHLKDMSTGLTLDKFFIQFECIPAS
EEKNVVEILDWSLCGTDSSRKAILKESTFVLILAPSNTSFVTTSSMQARLYEALRSGSIP
VFLGGDQILLSYSEVISWRRAAIFLPKARVTEMHFLLRAVLDTDLLSMRRQGRLIWEHYL
STAQGAVDTIVAVIRDRLGIPPLPAPQTASPSVFNESFVPLKSDTIIAEPEAEESLGPLE
PSYPSPAFKRNYTTMLLQGHEIWNDWVDPFYLYPQLPFDTVLPSDAKFLGSEMGFRPIGK
GAGGAGKEFSEALGGNYPREQFTIVMLTYEREQVLINSLARLYGLPYLNKVLVVWNSPKP
PMEDLKWPDIGVPIHVIKAPRNSLNNRFLPFDAIETEAVLSVDDDAHLRHDEIMFGFRVW
REHRDRVVGFPGRFHAWDQNYHNAWNYNSNYSCELSMVLTGAAFIHKHYTYLYTHWLPQA
IRDKVDEYMNCEDIAMNFLISHLTRKPPVKVTSRWTFRCPGCPVSLSEDDTHFQERHKCI
NFFSQVFGYMPLLNTQYRADSILFKTRIPHDKQKCFKFI
NT seq 6780 nt   +upstreamnt  +downstreamnt
atggcagaggtcattgattgtaattttcctgtttggggtcttttacctaaaaaagaaact
ggtgtcactcaatttcttaccaaatatcctgaatatgatggtcgaggagtcatcattgca
atttttgattcagggattgatcctggagctcctggtatgcaggaaacttcagatggaaag
ccaaaaattattgaaagatatgactgtagtggagctggagatgtagatactagtaaaatt
gtacaggcaccagatggatacataattggtataactggccgtaaattaaaggttccatct
aattgggtaaatcccagtggacaatatcatattggaataaagaatctatattcattatat
ccaggaaaattaagagaaagagtattagtagaaagaaaaaaacgtttatgggataataat
cataaatctgcacttgcagaagcatctagacaattacaagaatttgaagcaaagaatcca
caattaactactttaaaagaaagactagaaaaagaggaacttgaagccagagttgaaata
ttaaataatattgagaaaaaatattcagatgtaggacctacttatgactgtgttgttttt
catgatggtgaagtttggagagcatgtattgatacttctgaagaaggtaatttggaaact
ggtgtctttttaggagaatacactataacaaggcagtatgcaccacttatacccgaagat
caattaaatattagtattaatattcatgatgatggaaatacattagaaattgttagttta
tgctcaagtcatggtacacatgtagcttcaattgcggctgcatattttcctgataatccc
gaattaaatggtgtagctcctggtgctcaaattatttcattaagtgttggagatggtcgt
attggcacaatggaaacaggaactgcagtagtacgtgcaatgatacatgtaatgaaacac
aaagagaaaatacatgtaataaatatgagttatggagaacatgctcattggtccaatacg
ggaagaataggagaattaatgaatgaagttattgataaatatggtgtaacatgggtagca
tctgctggtaatcttgggcctgctttatgtactattggcacaccaccagatattagttct
aatagtgtaattagtgttggtgcttacgtttctcctgatatgatggtagctgaatattct
ttaagagaaaaaatgcctggtatgtcgtatacgtggtcatctcgtggtccaatgatcgat
ggtggagctggaattactgtatgtgctccaggaggagctataactagtgttcccaatttt
accttaagaaaaagtcaactcatgaatggtacaagcatggcagctcctcatgtaactgga
gctattgcaatacttatatcagggcttgttgccaaaggttgttcttattctccatatagt
ataaaaagagcacttgaaaatacagctcattatatacaaaatctagatccttttgcacaa
ggttcgggattattacaagttgaacgtgcattcgataatcttattacttactgtgatgta
cctgaaagagatgtaagatttactattaactgtggtccaaataatgctaaaggaattcat
atgagaagcagcattattgatcggccaaaagattatgccattactgttgaacctgtattt
cttaatagtgaaaatactgatccaacactcaaaattgcttttaatttgaaattaactttg
gtatgcgatgcatcttgggtacattttccaacacatcttgatttaatgaatatggttcgc
gcatttgcgatcaaagttgatggtttcaatttacccgaaggtgttcatacaactagtgtc
cgcgcttatgatgtaacagatgttgcaaaaggtccagtgttccaaataccagtaactgta
gtgcaaccacaaacactgccaaaaactgcgatccttccagacttaacttatacaaatatt
ttatttaaaccgaatacaatttatcgacattttattctcgttcctgaagatgcaacatgg
gcggtgattagattaaaaagcacagaaaaagataaaactggaagatttgtgatccatagc
gttcaattaaaacctcgactttcctgtaagactctcgaagttaataaattgtttactgtt
acttctcaatcagaaattgttcatccatttgctgttcagggcggattaatcttagaatta
gttattgcaaaatattgggcaaatataggcgacatgttagtcgattatgtcatagaattt
catggtgttcgtatgataagtggcaatcttacaatgcaatctggagatggtataaatcgt
ttagaagttcgaagttctcttagaaatgaagaagtagttcctagtatttgtctcaaatca
tctgtacaaatattaaagcctactgattcaaggattgcacctttacgagaacgagatatt
attccgccttcgcgacaaatttatgaattacaattaacatatacgttccattgtgcaaaa
gtaactgaaataactccaaatgcagcattacttagcgatttattatatgaaagtgaatat
gaaagtcaaatgtggatgatatatgacagtaataaacagcttatttgttgtggagatgca
tatccatcaaaatattctaatcaaaaaatagaaaaaggcgattatactttgaagatacat
atacgtcacgaaaagaaagatttacttgatagattaacagaaatgccgtttcttttgagt
cataaattaagtaatccaattaatttagatgtttatgccagtcaatcacaagctattatt
ggtggcaaaaaaatgatagcagcttcagttccacctggtcatattcttcctttatatatt
gctcctatatctaatgaaaacaaagtttccagaggtattaccttaggaagtggtagctat
ttacagggtacattgactttttgtaaagatgataatggaaaaaaagtggattgtcacaca
tttaaatatattttgtctgaaccaaacaagaaatctagtagtagcagtagcagcagtagt
agcagtagttcctacagttcatcaaacaaagaaaagcctactaaatgggatgaatataat
gaagcacttagggatttcaaatgcagttggcttacaaaacttgaacctggtgaatatgca
aatctactatatggagaattgaaaaatctcttctcggatcatttacctgttcacactgcc
atgctgatttccttggactctcctgaagctcgacgtcatgtaccccatgatgatatttca
gaagaatctgtttctctggcaaatcaaataataagtgtcgcagatgctgtgattactaat
attgatcaagataaactcttagcttattatggcttgaaaagcgatcaacgtgatgatgca
acaaagattagggcaactatggaaaaacaaaagttcagtttgataaaagcattagtgaaa
aaagggtgtgcattatcgcgattatatgtacacagtgcaaagaaaggagaaggagatcgt
caatcctatgaacatttattagatagtgtaacacatcattggcaagaagtacaaaaattt
gctgaaccaactgatatcaaggtcatttctctttcattatggcatgcccatattaataat
cattatggccgctatttaaaattattattacgttattatgaagaacatccattaaaagaa
gttgatgaaaaatgtatagaacttgcaaatatcttaggatgggaacatttatcacgtcat
attaatacgattagtgaagcatgtactctgatttgtcttcttgttgctcaacgaatatct
caaacaggattattaatatataatatagaaaaatctcctcaatttattgctatcatagct
gaagctatgatagaaggtaataacattcatgcatggattgttaagaaaggtttggtttct
catccgtatcttagtacagaagaagcattaaaacttggaggcagaaacttaaatctatta
agagaatgggtaactttttttgactctcatagtcatagtacaattgtaaatccaaatcgg
ggattagttattgcacaggtggaatctgattccccagataaagatatttatcgtacgttc
tccacactggaggcttttgaagattttactcctatgaaggcttctcaattgaaaatgaga
atagaggaaatgttgcgtattaaagtttctgtaaataatgaacttagggatctgagtgca
aagaggcaaagacttcaagttgaagttagtagtttaactcaaaaaattgatgaattaaaa
caagaattattgcatcaacaaactgatcttgatagattaaagatcagtgttgaacaagca
caagtagctcaaagagaagcagtggaaagaaatacaccagaattagcaccacctaaacgt
atattaatgaattctgttcctgtagtattacctaatactgtaccacattcatgtagaatg
tataattgttttgatcacagtcggtgtgcattaactagtggttttccagtatatttgtat
gatcctgatcagtattctgtagtaaattctggatgggatgttgatggatttttaaaaact
actataaaacaaacattaggatataatccacatctcactacaaatgcagctgaagcttgt
atatatatagtactcataggggaagctctctctattcaacaaaaagtagataaaaaattt
cgtaaacctatagatgtaaaaaaattacatgcactcccatattggggtggagatggcaga
aatcatattttattaaatttagcgcgtagagatttatctgtagaatctggtgatattttt
agtggaatagatacgggaagagctataatagtacaatccacattctttagaaatcaattt
cgtgagggatttgatttagttgtcccaccaattttaggacctccaggtggtgatgtctgg
caagaatgtgcacaaatgttgccagcaagaagaaaatatttattatcttttcaaggagaa
atgagatctccaaaaattactactatgacacatcaaattgatgatgcagatgtagatata
gaaaaattaacaattgatgaaaataatttggatgcttttattatacaacatcttaaagat
atgagtacaggattaactttggataaatttttcattcaatttgaatgtataccagcctct
gaagagaaaaatgtagtagaaatacttgactggtctttgtgtggaacagattcttcgagg
aaagctatattgaaagaatcaacatttgttttaattttagcgcctagtaatacatcattt
gtaaccacttcatctatgcaggctaggttgtatgaagcattacggtcgggttctatccca
gtttttttaggtggtgatcaaattttattaagttatagtgaagttatcagttggagacga
gcagctatctttttgccaaaggccagggtaacagaaatgcatttcctattacgtgcagtt
ctcgatactgatcttttaagtatgcgtagacaaggtagattaatatgggaacattattta
agtactgctcaaggtgcggtagatactattgtagctgtaattagagatcgactcggtata
ccacctttgccagcacctcaaactgccagtccaagtgtctttaatgaaagctttgtgcct
ttaaaatctgatactattatcgctgaaccagaagcagaagaaagtttaggacctctggaa
ccatcttatccatctcctgcatttaaaagaaattatactacaatgttacttcagggtcat
gaaatctggaatgattgggtggatccattttatttatatccgcaattaccttttgatacc
gtccttcctagcgatgcaaaatttcttggttctgaaatgggattcaggccgattggtaaa
ggtgctggaggtgcgggtaaggaatttagtgaagctctaggcggaaattatcccagagaa
caatttacaattgtgatgttgacatatgaacgagaacaagttcttataaattctttagct
cgattgtatggattaccatatttaaataaagttctagtagtatggaatagtccaaaacca
cctatggaagatttaaaatggcctgatattggagtaccaattcatgtaatcaaggctcca
aggaacagtttaaataatagatttttaccatttgatgctatcgaaacggaagctgttctt
tcagtagacgacgatgctcatttacgacatgatgaaattatgttcggattcagagtatgg
agagaacatcgagatcgtgttgttggatttcccggtcgctttcatgcatgggaccagaat
tatcacaatgcttggaactataattctaattattcatgcgaattatcaatggttttaact
ggtgctgcatttattcataaacattatacatatctatatacacattggttaccacaagca
attcgggacaaagttgatgaatatatgaattgcgaagatattgctatgaattttctgata
tctcatcttactagaaaaccacctgttaaagtcacatctcgatggacttttagatgtcct
ggttgtcctgtttctctttcggaagatgatacacattttcaagaaaggcacaaatgtatc
aatttcttctctcaggtttttggatatatgcctcttttaaatactcaatatcgagctgac
tcaatattatttaaaacgagaattccacatgataaacaaaaatgttttaaatttatataa

DBGET integrated database retrieval system