KEGG   Apis mellifera (honey bee): 550667Help
Entry
550667            CDS       T01057                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00020  Citrate cycle (TCA cycle)
ame00190  Oxidative phosphorylation
ame01100  Metabolic pathways
ame01200  Carbon metabolism
Module
ame_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ame_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ame_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    550667
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    550667
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     550667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 550667
NCBI-ProteinID: XP_006568498
BEEBASE: GB47043
UniProt: A0A088A6T4
LinkDB All DBs
AA seq 661 aa AA seqDB search
MSGLLKLSSLLVRNPPTTTLNKLGLPVITNRKLHYTPDGKAAKISDGVSKHYPLVDHTYD
AVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEDGECRGVIALCLEDGT
LHRFHSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMISRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGIPTNYKGQVLT
RKNDQDTVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTIAAENKPGETIGP
LKPNAGEESVANLDWVRNANGNVSTAELRLSMQKTMQTHAAVFRTAETLQEGCQKMSALY
KKLNDLKVLDKSMIWNSDLVESLELQNLMINAMQTIVAAENRKESRGAHAREDFKDRIDE
YDYSKSTENQKPRPLDQHWRKHTLTKINVRSGEVSIDFRPVIDNTLNKQECATVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtctattaaagctgtcgtctttactagtgagaaatcctcccacaacgacgttg
aataaattgggattacctgttattacaaatcgcaaattacattatacaccagatggcaaa
gctgcaaaaatctcagatggtgtttctaagcattatccattagtagatcatacttatgat
gctgttgttgttggtgctggtggagcaggattacgtgcagcttatggtttagttgctgaa
ggatttaagacagcagttgttactaaattatttcctacaaggtcacatactgttgctgct
caaggaggtatcaatgctgccttaggtaatatggaagaagataactggcagtggcatatg
tatgacactgtgaagggatctgactggttaggtgatcaggatgctattcattatatgaca
cgtgaagccccaaaggcagtcattgaattggagaattgtggcatgcctttcagtcgaact
tcagatggtaaaatatatcaacgtgcttttggtggacaatctctgaaatttggaaaaggt
ggccaagctcacagatgttgctgtgtagcagacaggacaggtcactctttacttcataca
ttgtatggtcaatctttgagttatgactgtaattattttgttgaatattttgctctggat
ttattaatggaagatggagagtgtagaggagtgattgctctttgtttggaagatggtaca
cttcatcgttttcattctaaaaacacagtattagcaactggaggatatggacgtgcatat
ttctcttgtacatctgctcatacatgcactggtgatggcactgcaatgatatctagagcc
aatttacctaatcaagatttagaatttgtacaatttcatcctacaggaatatatggagct
ggttgtcttatcacagaaggtagtcgtggtgaaggaggctatcttgtaaatagtgaaggt
gaaaggtttatggaacgttatgctccagttgcaaaagatttagcctctagagatgttgta
tctagatctatgactattgaaattcgggaaggcagaggtgttggtcctgaaaaagatcat
atttatttgcaattacatcacttaccacctgaacagttagcagctaggctacctggaatc
tctgaaacagcaatgatatttgctggagttgatgtaaccagagaacctattccagttata
cctacggtacattataacatgggaggaatacctacaaattacaaaggacaggttctaacg
agaaaaaatgatcaggatacagttgtgcccggactttatgcttgtggagaatcagcttgt
gcgtctgttcatggtgctaatcgtcttggtgcaaattcattattagatttagttgtattc
ggccgtgcctgtgctaaaacaattgcagcggaaaataagccaggagaaactattggccct
ctaaaacccaatgccggagaagaaagtgtggcgaacttggattgggtcagaaatgcgaat
ggtaatgtttctactgcagaattaagattgagcatgcaaaaaactatgcaaactcatgca
gctgtatttagaacagctgaaacattacaagaaggatgtcagaagatgtctgccttatat
aaaaaattgaacgatcttaaggttttggacaaatctatgatatggaattctgatcttgta
gaatctcttgaattacaaaatttaatgattaatgccatgcaaacaatagtagctgctgaa
aataggaaagaaagtcgtggagctcatgcacgtgaagattttaaagatagaatcgacgaa
tatgactacagtaagtcaacagaaaaccaaaaacctagaccattggatcaacattggcga
aagcatactcttacaaaaataaatgttagatcaggagaagtatctatcgatttcagacca
gttatagacaatactttaaataaacaagaatgtgcgacagttccacctgcaattcgttcc
tattag

DBGET integrated database retrieval system