KEGG   Apis mellifera (honey bee): 551005Help
Entry
551005            CDS       T01057                                 

Definition
(RefSeq) hexokinase type 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00010  Glycolysis / Gluconeogenesis
ame00051  Fructose and mannose metabolism
ame00052  Galactose metabolism
ame00500  Starch and sucrose metabolism
ame00520  Amino sugar and nucleotide sugar metabolism
ame01100  Metabolic pathways
ame01200  Carbon metabolism
Module
ame_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ame_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    551005
   00051 Fructose and mannose metabolism
    551005
   00052 Galactose metabolism
    551005
   00500 Starch and sucrose metabolism
    551005
   00520 Amino sugar and nucleotide sugar metabolism
    551005
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    551005
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     551005
Membrane trafficking [BR:ame04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    551005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 551005
NCBI-ProteinID: XP_006557645
BEEBASE: GB47079
LinkDB All DBs
Position
LG15
AA seq 481 aa AA seqDB search
MKTKNRSLFSRMCKCYGKESHAQVQQQIEEEPSTVAKVSDEIRDICKDLVLSDEKLRQLM
DTLNDQLHKGLGKETHATATTKCFPTYVQDLPQGTEKGNFLALDLGGTNFRVLLITLDEQ
NFDMKSKIYVIPQSLMVGTGVQLFDHIAHCLALFVKDLNLQNEVLPLGFTFSFPLDQHGL
TKGYLIRWTKGFKCDDIIGEDIVDLLEQAIKKRGDVKIQICAILNDTTGTLMSCAWKNKN
CRIGLIVGTGTNACYVEKLENIQTVYPENVLPGKPKMLINIEWGAFGEGTLLDFIATDID
RDVDENSINPAKQVFEKMISGMYMGELVRLLIEKAINAGLLFIGKSTNELKKRGRFYAKY
VSEIENDPNGKYTNCREVLAELGLRNVTDQDCENVKYICSVVSRRAAHLASAGIATLLNK
MDEDNVVVGIDGSVYRYHPHFHNLMTEKISQLQNHKFELMLSEDGSGRGAALVAAVAAGN
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaaaacagatcgctgttcagcaggatgtgcaaatgctatggcaaggagtcg
cacgcgcaggtacaacagcagatcgaagaggagccatccactgtggctaaagtatccgac
gagattagagacatctgtaaagacctggtcctctcagatgaaaaacttcgacagcttatg
gacactttgaacgaccaattacataaaggtctaggtaaggaaacgcatgctactgcgaca
acgaaatgcttcccaacctacgttcaagatcttccccaaggcacagagaagggcaacttt
ttggccctggatcttggcgggacaaatttcagagtactattgatcactctggatgaacag
aatttcgacatgaagagtaaaatttatgttataccgcaaagtttaatggtgggaaccggt
gtacaactcttcgaccacatagctcactgtttggccttgttcgtcaaggacttgaatctt
cagaatgaagttctacctcttgggtttacttttagcttcccattggaccagcatggacta
accaaaggctatttgatcaggtggacgaagggattcaaatgtgatgatataataggtgaa
gatatagttgatttacttgaacaggcgattaagaaaagaggtgatgtgaaaatccagata
tgcgccattttaaatgacactactggcactttgatgtcatgcgcttggaaaaacaagaat
tgccgtatcggattaattgtcggaactggtaccaatgcctgctacgtagaaaagttagaa
aacatacaaaccgtgtatccagaaaacgtattaccaggaaaacctaaaatgctgatcaat
atcgaatggggtgccttcggtgagggtacacttcttgattttattgcaacagacattgat
cgtgatgtcgacgagaattcgattaatccggcgaaacaagtattcgagaagatgatctct
ggcatgtatatgggagaattggtaaggttgctcattgagaaagcgataaatgctggacta
ttgtttatcgggaagtctaccaacgagctcaaaaaacgtggaagattctacgcgaaatac
gtttcagaaattgaaaatgatcctaatgggaaatatacgaattgtcgtgaagtattggca
gaattaggattgcgaaatgttactgatcaagactgcgagaacgttaagtacatttgctct
gttgtatcaaggagagcagctcatttggccagtgctggaattgctacattgttgaataaa
atggacgaagataatgttgtcgtaggaattgatggctcggtatatagatatcatccacac
tttcacaatcttatgaccgagaagataagccaattacagaatcataagttcgaattaatg
ctctccgaggatggtagcggtcgtggagcggcgctggtcgccgcagtggctgctgggaat
cgatga

DBGET integrated database retrieval system