KEGG   Apis mellifera (honey bee): 551529
Entry
551529            CDS       T01057                                 

Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ame04052]
    551529
   00536 Glycosaminoglycan binding proteins [BR:ame00536]
    551529
Cytokines and growth factors [BR:ame04052]
 Growth factors
  Growth factors (RTK binding)
   551529
Glycosaminoglycan binding proteins [BR:ame00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   551529
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 551529
NCBI-ProteinID: XP_006571081
BEEBASE: GB51941
LinkDB
AA seq 232 aa
MSLRWIHENLEAPTCDEECSDIDDSCSDDSYDSDLSIGEEKGPGSEKEINGDRRRKRETR
RHPTTTVKFDENGTSHYITSESVKRSPCVIWDPRKPAQNPVYNCLVIKLFCRTGYHLGVS
ESGRVRGLSATNEPHALLHIIPVSFGVVRIQNIETSLYLAFNKKGRLYGELNGNKDNTEW
EQWNVGSYDAFRSRKYANYGWWIGIKKNGRAKPGPRTSWGQKSIQFLAIRQE
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagtcttcgttggattcacgagaacttggaggcaccgacatgcgacgaggaatgcagc
gacatcgatgacagttgtagcgacgatagctacgattccgatctatcgattggcgaggag
aaagggccgggtagcgaaaaggagatcaatggggatcgtaggaggaaaagggaaaccagg
aggcatccgaccactacagtgaagttcgacgagaacggaacttcgcattacatcacgtcg
gaatcggttaaacgctcgccttgcgtaatatgggatcctaggaaaccggcacaaaatcct
gtgtacaattgtttggtaatcaagttgttctgtcgaaccggatatcatctcggtgtgtcg
gagtccggtcgtgttcgaggcttgagtgctacgaatgaaccacatgctttgcttcatatt
ataccggtgtcgtttggagtggtacgaatacaaaatatcgagactagtctttatctggct
ttcaataagaaaggacgtttgtatggagagttaaatggaaataaagataatactgaatgg
gaacaatggaacgttggttcctacgatgcttttcgatcgcgaaaatatgcgaattacgga
tggtggataggaataaagaagaatggtcgtgcgaaaccaggaccaagaactagttggggc
caaaaatcgatacaatttttagctatacgacaagaataa

DBGET integrated database retrieval system