KEGG   Apis mellifera (honey bee): 551904Help
Entry
551904            CDS       T01057                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    551904
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     551904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 FAD_oxidored EF-hand_8 EF-hand_5 GIDA Pyr_redox_2 EF-hand_9 HI0933_like Thi4 FAD_binding_3 Pyr_redox_3 NAD_binding_8 Methyltransf_34
Motif
Other DBs
NCBI-GeneID: 551904
NCBI-ProteinID: XP_006564634
BEEBASE: GB41798
LinkDB All DBs
AA seq 720 aa AA seqDB search
MASLKLLVGGASAIGASALTSYLLMSDNTVHADVCNPRPLKRPLPTREEQVKTLKNTSEY
DVLIIGGGATGAGCALDACTRGLKTALIEGDDFSSGTSSRSTKLIHGGVRYLQKAIMHVD
VEQYKMVKEALQERASMLHSAPHLAHPLPIMLPVYTWWQIPYFWVGIKMYDFVAGRKTVK
SSYFLSKRNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAIALTASRHGATVVNHVKVV
NLLKGLDKDGNRVLTGARVKDELTGEQWDVKAKAIINATGPFTDHIRKMDDQNVKEICSP
SSGAHIVLPGYYSPDQMGLLDPETSDGRVIFFLPWQKQTIAGTTDLPCEITHNPRPTEDE
IMFILREVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPDTQSLARNHIVHVSPTKLIT
IAGGKWTTYRAMAEETIDAAIKACDLKPERPCQTNGLLLEGAHGWSPTMYIRLVQDFGLE
CEVAQHLAKSYGDRAFAVAKMASLTGKRWPIIGKKLHPEFPYIDAEIRYGVREYARTAID
MIARRLRLAFLNVQAAQEALPGIIDIMAEELHWSPEEKNRQTKEASEFLANEMGQMVNRA
SRDKIPINLTKEEIQLYIKRFGIIDKDNKGYVSINDIRRGLKLFGDKEVPGEELHEILRE
IDTNMNGQVELDEYLQMMSAIKSGHVAYSRFARMAEMEEAQHEKEILKKQISVERSGGGL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctgaaactattagtgggtggtgcaagtgccatcggtgctagtgctcttact
tcttatctattaatgtccgataatacagtacatgcggatgtatgcaatccacggccatta
aagaggcctttaccaactagagaagaacaagtgaaaacattgaagaatactagcgaatat
gatgttcttattataggtggtggtgcaacaggagctggatgtgcattagatgcctgtaca
cgaggtttgaaaacagctttaattgaaggagatgatttttcttctggcacatcttctagg
agtacaaaacttattcatggaggcgtccgttacttacaaaaagctataatgcatgttgat
gtcgaacaatataaaatggttaaagaagcattacaagaacgagcgtctatgttacatagc
gcgcctcatttagctcatcctttgcctattatgttgcccgtatatacatggtggcaaatt
ccctatttctgggttggtataaaaatgtatgattttgttgctggaagaaaaacagtaaaa
tcgtcatattttctcagcaaaaggaatgcattagaattatttcccatgttgaaaggagac
aaacttacaggagctattgtttattatgatggtcaacaagatgatgccagaatgaattta
gcaattgcgctaacagcctcgcggcatggtgccacagttgtaaatcatgttaaagttgtt
aatcttttaaaaggtcttgataaggatggtaatcgagtccttactggtgcacgtgtgaaa
gacgaacttacgggtgaacaatgggatgtgaaagcaaaggcaataataaacgcaacaggt
ccattcacggatcatattagaaaaatggatgaccaaaatgttaaagaaatttgttctcct
tcttctggtgctcacattgttcttccaggttactatagtcctgatcaaatgggtttattg
gatccagaaacaagcgatggtcgagtaatttttttcttaccatggcaaaaacaaacaatt
gcaggaacaactgatttaccttgcgaaataacacacaatcctcgaccaactgaagatgaa
attatgttcattttacgtgaagtaaaaaactatctcaatccggatgttgaagttcggcgg
ggagatgtattatctgcttggagtggaattagacctctcgtttctgatccaaacaaaccg
gatactcaatctcttgccagaaatcatattgtacatgttagtcctacgaaacttatcaca
atagctggaggaaaatggacaacatatagagcgatggcagaggaaactatcgatgcagct
attaaagcttgcgatttaaaacctgaaagaccctgtcaaacaaatggtttacttcttgag
ggagctcatggttggagtccaacaatgtatattagactagttcaagattttggtttagag
tgtgaagttgcacaacatctagctaagagttatggagatcgtgcatttgctgtagcaaaa
atggcttctcttactggtaaaagatggccaattataggcaaaaaacttcatcctgaattt
ccatatatcgatgcagaaattcgatatggagttcgtgaatatgcgagaacagcaatcgat
atgatcgcaagacgattgagattagcctttttgaatgttcaagcagcacaagaagctctt
ccaggcattatcgatatcatggcagaagaattacactggtcgccagaagaaaaaaacagg
caaacaaaagaagccagtgaattccttgctaatgaaatgggacaaatggtcaatcgtgca
tctcgtgataaaattcctattaatctcacaaaagaagaaattcagttatatattaagcgt
ttcggaatcatcgataaagacaacaaaggctacgtttctattaatgatattagacgagga
cttaagctgttcggtgacaaagaagtacctggtgaagagcttcatgaaatattgcgcgaa
atcgacactaatatgaatggtcaggtcgaattggacgaatatcttcagatgatgtcggcc
ataaaatctggacatgtagcatattcacgttttgcaagaatggcagagatggaagaggca
caacacgagaaagaaatattgaaaaaacagattagtgtagaaagatcaggcggtggatta
taa

DBGET integrated database retrieval system