KEGG   Apis mellifera (honey bee): 552118Help
Entry
552118            CDS       T01057                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00480  Glutathione metabolism
ame00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    552118
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    552118
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     552118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 552118
NCBI-ProteinID: XP_006569695
BEEBASE: GB44803
UniProt: A0A088A0S0
LinkDB All DBs
AA seq 241 aa AA seqDB search
MSSKHLTIGSVAPPIVPGKIRLYSMRFCPYAQRIHLVLDAKHIPHDVVYVNLTHKPDWLL
EKSPLGKVPCIELEGGEILYESLVIAEYLDDTYPQNKLYPNDPLARAKDKLLIGRFNSVI
NTMCKLFINTSIDQDIFDEALSELELFERELASRGTPFFHGNSPGMLDFMIWPWWERSNT
IKMLRGDQFTIPHDRFKRLLEWRSAMKENPAIRSNYLDTEIHAKYMQSRRAGTPQYDLIT
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagttctaaacatttgactatcggatcagttgctccacccattgtacctggaaaaata
cgtttatatagtatgcgattttgtccatatgcccaaagaattcatttagtacttgacgcg
aaacatatacctcatgatgttgtttatgtaaatttgactcataaacctgattggctacta
gaaaaaagtcctttgggtaaagttccatgtatagaattagaaggaggagaaatattatat
gaaagtcttgtaattgctgaatatttggatgatacatatccacaaaacaaactatatcct
aatgatcctctagctagagctaaggataagttgttaattggtagatttaattctgttata
aatactatgtgtaagttgtttattaatacatctatagatcaagatatatttgatgaagct
ttatcagagttggaactttttgaaagagaacttgcatcaagaggtacaccattctttcat
ggtaattctcctggcatgttagattttatgatatggccatggtgggaaagatccaataca
attaaaatgctacgtggagatcagtttactataccacatgatagatttaaaagactgttg
gaatggagatctgccatgaaagaaaatcctgctattagatctaattatcttgatactgaa
attcatgctaagtacatgcaaagtcgtcgtgctggaactccacaatatgatttgattact
gattaa

DBGET integrated database retrieval system