KEGG   Apis mellifera (honey bee): 552328Help
Entry
552328            CDS       T01057                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00500  Starch and sucrose metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    552328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ame01003]
    552328
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     552328
Glycosyltransferases [BR:ame01003]
 Polysaccharide
  Storage polysaccharide
   552328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 552328
NCBI-ProteinID: XP_624707
BEEBASE: GB54391
UniProt: A0A088ARU9
LinkDB All DBs
Position
LG16
AA seq 692 aa AA seqDB search
MSRERVSRRFYRMDSSNDLLEFMDRGYSAQHENRWYFEVAWEAANKVGGIYTVIRSKAYV
STEEMGDQYCLIGPYKETSARTEVEEADFPHNNPLHIAVQVLRDQGFKVVTGTWLVDGNP
QIILFDIGSAAWKLDEYKQELWNTCNLGIPHLDIESNDAVILGYLVCQFISEFRLAAEGY
IDVPPRIVVHCHEWQAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGKTDFYNNLDLFN
VDEEAGKRQIYHRYCMERAATHLAHIFTTVSDITGFEAEHLLKRKPDIITPNGLNVKKFA
ALHEFQNLHAVSKEKIHEFVRGHFYGHYDFDLDKTLYFFIAGRYEFGNNGADIFIEALAR
LNHYLKTSRPDITIVAFLIFPARTNNFNVESLRGHAVTKSLRDTINDIQQKIGKRMYEMC
LSGRMPDVQDLLQKEDTIKIKRCLYALQRNGLPPVTTHNVIDDWNDPVLNAIRRCNLFNT
VHDRVKIVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYIVDRRFISLESSVQQLAQYMFDFARLSRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARIKALTTVYPELASEFAEGGVGRFSYPRPISEPPSPSSSR
HTTPAASVHGSDEEDEVDDEKELEELRQTSGR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagagaacgtgtatctagaagattttatcgtatggacagtagtaatgatttactt
gaatttatggatcgtggatattcagcacagcatgaaaatcgatggtattttgaagttgca
tgggaagctgctaataaagttggtggtatatatactgtaatacgttctaaagcttacgta
tctacagaagaaatgggtgatcaatattgccttattggtccatataaagaaacttcagca
cgtactgaagttgaagaagcagattttccacataataatccattgcatatagctgtacaa
gttttacgtgatcaaggatttaaagtggtaacaggaacctggctagtggatggaaatcca
caaatcattctgtttgatattggaagtgcagcatggaagttggacgaatataagcaagaa
ttatggaatacttgtaatcttggtattcctcatttagatatagaatctaatgatgcagtt
attctcggttatctcgtttgtcaatttatttctgaattcagattagctgctgaaggatat
attgatgttcctcctcgtatagtggttcattgtcatgaatggcaagctggtgtcggttta
attgctttaagaactagacatgtagatgttgctacggtttttactacacatgctactttg
cttggaagatacctatgtgcagggaagactgatttttataacaatttagatttgtttaat
gtagatgaagaagcgggaaaacgccaaatttatcatagatattgtatggaacgtgcagct
acacatttggcacatatatttacaaccgtttcggacataaccggtttcgaagcagagcat
ttattgaaaagaaaacccgatataatcacgccgaatgggctcaatgtaaaaaaatttgcg
gcacttcatgaatttcaaaatttgcatgctgttagtaaagaaaaaatacatgaattcgtc
agaggacatttttatggacattatgattttgatttggacaaaactttatattttttcatt
gctgggcgttatgagtttggaaacaatggtgccgatatatttatcgaagctttggctaga
ttaaatcattatttaaaaacatctagacctgatataactattgtggctttcttaattttt
ccagcacggactaataattttaatgtagaatcattgcgtggtcatgctgtcacaaaatct
ttgagagatacaattaatgatatacaacaaaaaataggaaagcgcatgtatgaaatgtgc
ctttctggtcgtatgcctgacgtgcaagaccttttgcaaaaagaagatactataaaaatc
aaacggtgtttatatgcgttacaaaggaatggtttgcccccagttaccacacataatgtt
atagatgattggaatgatccggtattaaatgctattagaagatgcaacctttttaacact
gttcacgatcgagtaaaaatagtatttcatccagagttcctatcatcgacaaatccatta
tttggtctcgattatgaagaattcgtcagaggatgtcatttgggtgtctttccatcatat
tatgaaccttggggatatacacctgcagaatgtactgttatgggtattcctagtataact
acaaatctatctggattcggatgttttatgcaagagcatatagctgatccaatgagttac
ggtatttatattgtggataggcgatttattagcctagaaagtagtgttcaacaacttgcc
caatatatgtttgattttgcacgattaagtcgtcgacaacgtattattcaaagaaatcgt
acagaacgtcttagtgatcttcttgattggagaaatcttggtatttattatcgccaagct
agaatcaaagctttgacgactgtttatccagaattagcttctgaatttgccgaaggtgga
gtaggacgttttagttatcctagaccgattagtgaaccaccgtcaccttcttcttctaga
catactactccggctgcttcggttcacggatctgacgaagaagatgaagtagatgatgag
aaagagttagaagaattgcgccaaacaagtggcagataa

DBGET integrated database retrieval system