KEGG   Apis mellifera (honey bee): 724565Help
Entry
724565            CDS       T01057                                 

Gene name
SP18
Definition
(RefSeq) trypsin-7
Organism
ame  Apis mellifera (honey bee)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 724565
NCBI-ProteinID: XP_016768428
BEEBASE: GB41097
UniProt: A0A087ZQQ2
LinkDB All DBs
Position
LG6
AA seq 247 aa AA seqDB search
MWRVLLLLSTVLYITHCLQPRIIGGHNASIIEYPYQVSIHYMGKHHCGGSIISENWLLTA
AHCIYGLIPVNFKIRAGSIYNNNGIEYNIKNIIMHEKYNIYTFDYDVALIMLSTPIKISP
TTKPIALAQSTTSVEIGKNAVVTGWGYLSVNSNSMSDILQVLTLPIVDQNVCKTIFSGIN
TVTENMICAGSLTGKDTCKGDSGGPLVYNNVQIGIVSWGLKCALPNYPGVYTRVSAIRDW
IKKKTGV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtattgttgttgctctccacggtcctatacataacgcactgtctccaaccc
aggattataggaggacataacgcgtccatcatcgagtatccgtatcaggtgtctattcat
tatatgggaaagcatcattgcggagggtccataataagcgaaaattggctgctaacggca
gcgcattgtatctacggattgatccctgtcaactttaaaattcgtgcaggcagcatttat
aacaacaatggcatcgagtacaatatcaaaaatataattatgcacgagaaatacaatatt
tatacgtttgattacgacgtcgctttgataatgctgtcgacccccataaaaataagcccg
accacgaaaccgatcgcgctggctcagtccacgacctcggtggagattggaaaaaatgca
gtggtgacaggatggggctatttgtcggtaaatagtaacagcatgtccgacattttgcaa
gtcttaacgttgcctatcgtggaccaaaatgtgtgcaagacaattttcagtggaatcaat
acggtgacagaaaatatgatctgcgcgggaagtttgactggaaaagatacttgcaaaggt
gattccggaggtccattggtgtacaacaacgttcaaattggcattgtatcctggggcctt
aaatgtgcgttacctaactatcctggtgtatacacgcgagtgtccgccatacgagattgg
ataaagaagaagacaggcgtatag

DBGET integrated database retrieval system