KEGG   Apis mellifera (honey bee): 725144
Entry
725144            CDS       T01057                                 

Definition
(RefSeq) uncharacterized protein LOC725144 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    725144
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 725144
NCBI-ProteinID: XP_001120073
BEEBASE: GB55604
UniProt: A0A088AV50
LinkDB
AA seq 160 aa
MPVNSDTRPIRTSGDRQVTSERPRARLMMQYPNIDIQEGRRIRSVRRRLFQDDDDDNETE
SGRNSRIEDNVANCFFEEARKYRENAKERWNFDFEKEEPLPGRYVWVKLDQHGNEIRNPL
EANSRVENIQTMQEEDAQDDDVTMQDHAEDKDDDKMTDST
NT seq 483 nt   +upstreamnt  +downstreamnt
atgccggtgaattcggatacgcgaccgattcgtacctccggggaccgacaagtaacgagc
gaacgacctagggctcgactcatgatgcaatatccaaacatcgatatacaagaggggaga
aggattcgtagcgtgcgaagaagactttttcaagacgacgatgacgataatgaaacggaa
tcggggcgaaattcccgtatcgaggacaatgttgccaattgttttttcgaagaggctcga
aaataccgagagaacgctaaggagagatggaacttcgacttcgagaaggaggaacctcta
cccggtcgttacgtatgggtgaagcttgatcaacacggaaatgaaattcgtaatccgctg
gaggcgaacagccgagtagaaaatatacaaacgatgcaggaagaagacgcacaagacgat
gacgttacgatgcaagatcatgcggaggataaggatgacgataaaatgactgatagtacg
tga

DBGET integrated database retrieval system