KEGG   Apis mellifera (honey bee): 725938Help
Entry
725938            CDS       T01057                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ame01009]
    725938
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ame03019]
    725938
   04131 Membrane trafficking [BR:ame04131]
    725938
   03036 Chromosome and associated proteins [BR:ame03036]
    725938
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     725938
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     725938
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     725938
Membrane trafficking [BR:ame04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    725938
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     725938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 725938
NCBI-ProteinID: XP_026298851
BEEBASE: GB42847
LinkDB All DBs
AA seq 1168 aa AA seqDB search
MMALLSNSMICKDLFTAVKQLADSEIELIKTIENSKKTNNIKNIKNTMSTTDKKSVKKST
KVFNVRPSAALIAAKREAAQQRILQEKKSNNVFIYDIYQKAIDAYNIKRMETGIVFDHSM
AEHKCLWDSNYPECPARLIRVLQRCEELGLISRCKLITPRLASENEILIKHSQEQIDILK
STDGCTDINNLELLSSKYDAIYIHPSTYRLSLLAVGSTINLVESICKGEIQNGMAIIRPP
GHHAMKSEYCGYCFFNNVAIAAEKVLCNNLASKILIVDWDVHHGQATQQMFYDNPQVIYF
SIHRYENGEFWPNLRESNFHFVGDDLGEGYNFNVPLNKIGMTNADYLAIFQQVLLPMAYE
FQPDLIIVSAGYDAALGCPEGEMLITPACYAHLLSSLLCLASGKVAVILEGGYCLKSLSE
SAALTLRTLLSDPCPMLETLTLPSISIRDTILNTIYTHKPYWKCYQYQDTYSINSTPNNK
EENTNQYLPVIIFKETDVRPKVYETQNCYPVQTQEIIEIIEKQLSTLIQFTNLSKAPNKV
CIVYDDRMLKHYDISDANHPEKPHRINIIYKKFQEYNLLDRSFVQQGRSATKEELLLVHT
KEYIDKIKNTKNLKSKELKKQAETYNSVYLHPETWSSACISTGSLLQVVDNVLNGESQSG
IAIIRPPGHHATEDAACGFCIFNNVAIAAKYAIEFHHVKRVLIVDWDVHYGNGTQSIFEE
DSKVLYISIHRYDNGSFFPNSKRANYSYVGSESGEGFTVNIPWNKKGMGDAEYIAAFQQI
IMPIAYQFNPELILVSAGFDACIGDPLGGCFVTPELYGHLTHWLSSLANGRVILSLEGGY
NTNSIAHAMAICTKSLLGDPLPILESGQIPCASAVHTIHNVLKTQKQYWPNLIFNLSLPK
EKILSKPKVSYKKTNEQIINNEELLKYSESKIALEEIETEKMQNKKIATWKFINKIKNVD
EKDLSDKLDEAIDSYYELQNIQLNDNTFYNEVSKYTKTCMNQDQKEGHSNENFTSFAAGS
SGKQNERIITQTSGNKNLYDYFSENLQALVAGDMFAVIPLKECPHLDSIRDVPALGIDVH
LPCVECESTAENWICLQCYIIHCARNINQHGVLHAEKMEHPLALSFSDLSVWCYKCEAYI
DNPRLFAARNAAHQSKFNEELPWTYNDD
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgatggcattactgtctaattctatgatatgtaaagatttattcactgctgttaaacaa
ttagcagacagtgagattgaattaataaagactatagaaaattcaaagaaaacaaataat
attaagaatattaaaaatactatgtctacaacagataaaaaaagtgtcaaaaagtccaca
aaagtattcaatgttcgtccatcagctgctttaatagcagctaaacgtgaagcagctcaa
caacgtatattacaagaaaaaaaatctaataatgtttttatatatgatatatatcaaaaa
gctattgatgcatataatataaaaagaatggaaactggtattgtatttgatcattctatg
gctgaacataaatgtctttgggattcaaattatccagaatgtcctgctagattgataaga
gttttacagagatgtgaagaattgggcttaataagtagatgcaagttgataacaccaaga
ttagcttcagagaatgaaatacttataaaacatagtcaagaacaaatagatattttaaag
agtactgatggatgtacagatataaataatttagaattattatcatcaaaatatgatgcc
atttatatacatccttctacttatcgattgtctctattagccgtgggttcaacaataaat
ttagtagaaagcatttgcaaaggagaaatccaaaatggaatggctattataagaccacca
ggacatcatgcaatgaaatcagaatattgtggatattgttttttcaataatgttgcaata
gctgctgaaaaagttttatgtaataatttagctagtaaaattttaattgttgattgggat
gtacatcatgggcaagctactcaacaaatgttttatgataatccacaagtaatttatttc
tctattcatcgttacgaaaatggtgaattttggccaaatcttagagaatctaattttcat
tttgttggagatgacttaggagagggatataattttaatgtgccacttaataaaattggt
atgactaatgctgattatttagctatatttcaacaagttttattgccaatggcctatgag
tttcaaccagatcttataatagtatcagctggttatgatgcagctttgggttgtccagag
ggtgaaatgttgataacaccagcatgttatgctcatttactatcatcattattatgtttg
gcttctggaaaagttgctgttatattagagggtggttattgtttaaaatcattaagtgaa
agtgcagcattaacattgcgtactttgttaagtgatccatgtcctatgttagaaactctt
acattaccttcaataagtatacgtgatacaattttgaatacaatttatacacataaacca
tattggaaatgttatcaatatcaagatacatatagtattaatagtacaccaaataataaa
gaagaaaatactaatcaatatttacctgtaattatattcaaagaaactgatgttaggcca
aaagtatatgaaactcaaaattgttatccagttcaaactcaagaaattattgaaataata
gaaaaacaactgagtacgttaatacaatttactaatttgtctaaagcacctaataaagta
tgtattgtttatgatgatagaatgctaaaacattatgatatatctgatgctaatcatcca
gaaaaaccacatcgtattaatattatttataaaaaatttcaagaatataatctacttgat
cgaagttttgtgcaacagggacgaagtgcaacaaaagaagagttattattagttcataca
aaagaatatattgataaaataaaaaatacaaaaaatttaaaatcaaaagagctaaagaag
caggcagaaacatacaattcagtttatttgcatcctgaaacatggtcaagtgcttgtata
tcaactggatcattactacaagtagttgataatgttttgaatggagaaagtcaatctggt
attgctatcattagacctccagggcatcatgctacagaggatgcagcatgtggtttttgt
atttttaacaatgtagctatagcagctaaatatgccatagaatttcatcatgtaaaaaga
gtattgatagtagattgggatgtacattatggtaatggaactcaatctatttttgaagaa
gactctaaagttttatatatatctattcatcgttatgataatggtagtttttttccaaac
tctaaacgagcaaattattcttatgttggttctgaatcaggagaaggtttcactgttaat
ataccatggaataagaaaggaatgggtgatgcagaatatatagcagcgtttcagcaaata
ataatgccaattgcttatcagtttaatccagaattgattttagtttctgctggttttgat
gcctgtattggtgatcctttaggaggttgttttgtaacaccagaattatatggacacttg
acacattggctatcttctttagctaatggtcgtgttattcttagtcttgaaggaggttac
aatactaattcaattgcacatgcaatggctatttgtacgaaatcattgcttggtgatcct
ttaccaatattagaaagtggacaaattccatgtgcgagtgctgttcacactatccataat
gttttaaaaacgcaaaaacaatattggccaaatttaatatttaatttatcattaccaaaa
gaaaaaatactttctaaacctaaagtgtcatataaaaaaacaaatgaacaaattataaac
aacgaagaacttttaaaatattctgaatctaagatagcattggaagaaattgagacagaa
aaaatgcaaaataaaaaaattgcaacctggaaattcataaacaaaattaaaaacgtagat
gaaaaagatcttagtgataaattagatgaagcgattgattcatattacgagttacaaaat
attcaacttaatgataatactttctataacgaagtttctaaatatacaaagacatgtatg
aatcaagatcaaaaagaaggacattctaatgaaaattttaccagttttgctgctggtagt
agtggtaaacagaatgaaagaataattacacaaacaagtggcaataaaaatttatatgat
tatttttcagaaaatttacaagcactagtagctggagacatgtttgcagtaataccttta
aaagaatgtccacatttagatagtattagagatgtaccagctttgggaattgatgtacat
ttaccttgtgtagaatgtgaaagtactgctgaaaattggatctgtctacagtgttatatt
attcattgtgcacgtaatattaatcaacatggtgtattacatgctgaaaaaatggaacat
ccattggcactaagttttagtgatttatcagtttggtgttataaatgtgaagcatacatt
gataatccacgattatttgctgctcgtaatgctgcacatcaaagcaaatttaatgaggaa
ttgccatggacatataatgatgattga

DBGET integrated database retrieval system