KEGG   Apis mellifera (honey bee): 726855Help
Entry
726855            CDS       T01057                                 

Definition
(RefSeq) vegetative cell wall protein gp1
Organism
ame  Apis mellifera (honey bee)
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 726855
NCBI-ProteinID: XP_001122571
BEEBASE: GB44100
UniProt: A0A087ZYV9
LinkDB All DBs
AA seq 351 aa AA seqDB search
MKKFFIILLAIGLVSLQSGDALKCRICKGNCDSQNQNEIQVQECSASNVESSTSVPSTPE
SSSPGTSSPGTSSPGTSSPGASSPGASSPEPSSPEPSSPEPSSPEPSSPGTSSPEPSSPE
PSSPESSSPGTSSPGTSTPAPPTPAPSTPAPSTPAPPTPAPSTPTPPTPASSTPTPSTPA
PSTPAPSTPTPSTPAPSTPTTSTPAPSTPAPSTPAPSTPAPSTPAPSTPAPSTPAPSTST
STTQKSKGSEDKEDKHFMGYFNDRNERKRRSLLNRFSSEINARANDSTFYCFTMKNDEGK
IAELGCTSDKNICENNEKCIICDKDECNSATSNTIFASMVFSLSVIIFFMK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttttcataatattgctggccatcggcctcgtctctctacaatccggggac
gcgctcaagtgcagaatatgtaagggaaattgtgattcacaaaatcaaaatgaaatccaa
gtgcaggaatgtagcgcatcgaatgtagaatcatcgacttcagtaccatcgactccagaa
tcatcgagtccaggaacatcgagtccaggaacatcgagtccaggaacatcgagtccagga
gcatcgagtccaggagcatcgagtccagaaccatcgagtccagaaccatcgagtccagaa
ccatcgagtccagaaccatcgagtccaggaacatcgagtccagaaccatcgagtccagaa
ccatcgagtccagaatcatcgagtccaggaacatcgagtccaggaacatcgactccagca
ccaccgactccagcaccatcgactccagcaccatcgactccagcaccaccgactccagca
ccatcgactccaacaccaccgactccagcatcatcgactccaacaccatcgactccagca
ccatcgactccagcaccatcgactccaacaccatcgactccagcaccatcgactccaaca
acatcgactccagcaccatcgactccagcaccatcgactccagcaccatcgactccagca
ccatcgactccagcaccatcgactccagcaccatcgactccagcaccatcgacttcaaca
tcaacgactcaaaaatcaaaaggatcggaagacaaagaagacaaacatttcatgggttat
ttcaatgatagaaatgaaaggaagcgtagaagtttgctcaaccgtttttcctcagaaata
aatgcacgcgcaaatgattctactttctattgttttactatgaaaaatgacgaaggaaaa
atcgcggaattgggatgtacttctgacaagaacatttgtgaaaataatgaaaagtgtatc
atatgtgacaaagatgaatgtaattcggcaacatcgaatactattttcgcttctatggtg
ttctctttgtcggtaatcatatttttcatgaaataa

DBGET integrated database retrieval system