KEGG   Apis mellifera (honey bee): 726958
Entry
726958            CDS       T01057                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X1
  KO
K16679  wengen
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04013  MAPK signaling pathway - fly
ame04214  Apoptosis - fly
ame04215  Apoptosis - multiple species
ame04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    726958
   04391 Hippo signaling pathway - fly
    726958
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    726958
   04215 Apoptosis - multiple species
    726958
SSDB
Motif
Pfam: TNFR_c6 HCO3_cotransp Trp_oprn_chp
Other DBs
NCBI-GeneID: 726958
NCBI-ProteinID: XP_001122675
BEEBASE: GB45547
UniProt: A0A088A2R5
LinkDB
AA seq 296 aa
MPREPNRGYLLAVLLVLVGLRKAGCSTSVPRYPVCKPGFEFWSVEHATCLPCTRCAPDFT
LSPCAIYKDAICGPLSALELDWSFLSTRKRPEIGQRSLEAVTSKMLWRFPDLDQQQIRQE
SKDFIDSSEQNIQWETKNEALNEPHSRSTAISKERILWDWQTVALILAVCACILFFLVAG
CSALIYARQWRRMKKNFEPVGLEEISARLNLMVKAELAELVSGAPMNPGDPETRCQYLEK
LLDRRRESPVMVDWPEVNGNVYIEDGEPSKSKKLQIARIHRNIETILNQKKNFSDS
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcctcgggagcccaatcggggatatctgttggccgtgctgctagtattggtcggtctc
cgcaaggctggctgttcaacatccgttccccgatatccggtctgcaaaccaggtttcgaa
ttttggtcggtcgaacatgccacctgtttaccttgcaccagatgcgctcctgattttact
ttgagcccttgcgcgatttacaaggatgccatttgtggtccactctctgctcttgaactc
gattggtcttttctttcgacgagaaaacggccggaaatcggtcaaagaagcctcgaagca
gttacttcgaagatgttatggaggttcccagatttggatcagcaacagattagacaggaa
tcaaaggattttattgatagttcggagcaaaatattcaatgggaaacaaagaatgaggca
ttgaacgagcctcattcaagaagcacagctatttcaaaagagagaattttgtgggactgg
caaacggtcgcattgatccttgccgtatgcgcctgtattctcttttttctggtcgcagga
tgctcggctttaatctacgccagacagtggcgtcggatgaagaagaacttcgaacccgta
ggtctagaagagatctcggctcgattaaatttaatggttaaggcggaactagccgaactg
gtttccggcgcacccatgaaccctggtgatcccgaaacaaggtgccaatatctcgagaaa
cttctagatcgaagaagagagtctcctgtgatggtcgattggccggaagtcaacggaaac
gtttatatagaagatggagagccttcaaaaagcaagaaactacaaatcgctaggattcat
cgaaatatcgagacgattttaaatcagaaaaaaaatttcagcgattcatag

DBGET integrated database retrieval system