KEGG   Aeromonas media: B224_0793Help
Entry
B224_0793         CDS       T03075                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
amed  Aeromonas media
Pathway
amed00061  Fatty acid biosynthesis
amed00620  Pyruvate metabolism
amed00640  Propanoate metabolism
amed01100  Metabolic pathways
amed01110  Biosynthesis of secondary metabolites
amed01120  Microbial metabolism in diverse environments
amed01130  Biosynthesis of antibiotics
amed01200  Carbon metabolism
amed01212  Fatty acid metabolism
Module
amed_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B224_0793
   00640 Propanoate metabolism
    B224_0793
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B224_0793
Enzymes [BR:amed01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     B224_0793
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     B224_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp GARS_A ATP-grasp_4 DUF3182
Motif
Other DBs
NCBI-ProteinID: AHX59844
UniProt: A0A023RH43
LinkDB All DBs
Position
complement(597918..599258)
Genome map
AA seq 446 aa AA seqDB search
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLADETICIGKPASGESY
LNVPAIIAAAEVTGAVAIHPGYGFLSENADFAEVVEKSGFIFIGPRAETIRLMGDKVSAI
EAMKKAGVPCVPGSDGPVDNDAKRNATIAKRIGYPVIIKAAGGGGGRGMRVVRNESELAA
AIALTKSEAGQFFKNDMVYMEKYLENPRHIEIQVLADGQGTALYLGERDCSMQRRHQKVV
EEAPAPGITEEMRKFIGERCVRACLEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMVTGVDLIKEQLRIAAGQPLSITQQDIRIRGHAIECRINAEDPATFMPSPGLIQRFHAP
GGLGVRWESHIYAGYKVPPYYDSMIGKLICYGENRDIAIARMRHSLDELVVEGIKTNIAL
QKEIMKDENFQHGGTNIHYLHKKLGL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaaagtagtcatcgccaaccgcggtgaaattgccctgcggatcctgcgcgcc
tgcaaagagctcgggatcaagacagtggccgttcactccactgccgatcgggagctcaag
catgtgctcctggccgacgaaaccatctgtatcggcaaacccgccagcggtgagtcctac
ctcaacgtgccggccatcatcgccgccgccgaggtgaccggtgccgtcgccatccacccg
ggctacggcttcctctccgagaacgccgactttgccgaagtggtcgaaaaatccggcttc
atcttcatcggcccgcgcgccgagaccattcgcctgatgggtgacaaggtctccgccatc
gaggcgatgaagaaggcgggcgtaccctgtgtacccggctccgacggcccggtggacaac
gatgccaagcgcaacgccaccatcgccaagcggatcggctaccccgtgatcatcaaggcc
gccggtggcggtggtggtcgtggcatgcgcgtggtgcgcaacgagtcggagctggccgcc
gccatcgccctgaccaaatccgaagcgggccagttcttcaagaacgacatggtctacatg
gagaaatacctggagaacccgcgccacatcgagatccaggtgctggctgacggccagggt
accgccctctacctgggtgagcgcgactgctccatgcagcgccgtcaccagaaggtggtg
gaagaggcgccggcacccggcatcaccgaagagatgcgcaagttcatcggtgagcgctgc
gtgcgcgcctgtctcgaaatcggctaccgcggtgcgggcaccttcgagttcctgtacgag
aacggcgagttctacttcatcgagatgaacacccggatccaggtcgagcacccggtcacc
gagatggtcaccggtgtggatctcatcaaggagcagctgcgtatcgccgccggccagccc
ctgtcgatcacccaacaggacatccgcatccgtggccatgccatcgagtgccggatcaac
gccgaagacccggccactttcatgccgtctcctggcctcatccagcgcttccacgcgccg
ggcggtctgggcgtgcgttgggaatcccacatttatgcgggttacaaggtgccgccctac
tacgactccatgatcggcaagctgatctgttacggcgagaaccgtgacatcgccatcgcc
cgcatgcgtcactctctcgacgagctggtggtggaagggatcaagaccaacatcgccctg
caaaaagagatcatgaaggacgagaacttccagcacggtggcaccaacatccactacctg
cacaagaagttgggtctgtaa

DBGET integrated database retrieval system