KEGG   Aeromonas media: B224_2007Help
Entry
B224_2007         CDS       T03075                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amed  Aeromonas media
Pathway
amed00564  Glycerophospholipid metabolism
amed01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B224_2007
Enzymes [BR:amed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B224_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 Thi4 Pyr_redox_2 DAO_C 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHX60721
UniProt: A0A023RGQ2
LinkDB All DBs
Position
complement(1574495..1576177)
Genome map
AA seq 560 aa AA seqDB search
MKRITTEVVIIGGGATGAGIMRDCALRGIDCILLERDDIAAGTTGRNHGLLHSGARYAVT
DPESARECIQENRILKRIASHCVEATGGLFLTLPEDDINFQSTFMDACALAGIDTRQLDP
REALRLEPNANPAMIGAIHVPDGTVDPFRLAAANVLDAKEHGARIFTHSKVLGLLRTQDR
VHGVKAINTRTGEAFEVECQEVINAAGIWGQQICEYADLGIRMFPAKGSLLIMDYRINQL
VLNRARKPADADILVPGDTISLIGTTSSRIDYNKIDQLTVEPEEVEVLLREGIKLAPIMA
RTRLLRAYAGVRPLVAVDGDESGRNISRGIVLLDHSDRDGLKGFNTITGGKLMTYRLMAE
WATDLVANKLGNSRPCRTAELSLPGSRDPEKVSAPGLSVPAEGSAQYRHGERVIAFFRDN
PKANALICECEMVTAGEIEYALRELDVDNLVDLRRRTRLGMGPCQGELCAYRAAGLMQEY
GKADGREACVMLRQFLEERYKGTRPVLWGDALREAEFTYWIYEWLFGLGEWTAPHLVAEP
PFPLDASTAANPTKECSHEI
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataaccacagaagtcgtcatcataggcggcggcgccaccggggccggcatc
atgcgcgattgcgcgctgcgcggtatcgactgcatcctgctggagcgggatgacatagcc
gcaggcaccacggggcgcaaccacggcctgctccattcgggggctcgctacgcggtgacg
gatccggagtccgcccgcgagtgcattcaggagaaccgcatcctcaagcggatcgccagc
cactgcgtggaggcgaccggcggcctcttcctcaccctgccggaagatgacatcaatttc
caaagtacctttatggatgcctgtgccctggccggtatcgacacccgccagctggatccc
cgcgaggcgctgcgcctcgaacccaacgccaacccggcgatgataggcgccattcatgtg
ccggatggcaccgtcgatcccttccgcctggccgccgcaaacgtcttggatgcaaaggaa
catggcgcccgcatcttcactcacagcaaggtgctggggctgctgcgcacgcaagatcgg
gtgcacggggtcaaggccatcaacacccgcaccggcgaagcgttcgaggtggagtgccag
gaggtgatcaacgccgccggcatctggggccagcaaatctgcgaatacgccgatctcggc
atccgcatgttcccggccaaaggctccctgctcatcatggattaccgcatcaaccagctg
gtgctcaaccgtgctcgcaaaccggcggacgcggacattctggtgccgggcgataccatc
tccctcatcggcaccacgtccagccgcatcgattacaacaagattgatcagctcaccgtc
gaacccgaagaggtagaagtgctgctgcgcgaggggatcaagctcgcccccatcatggcg
cgcacccgtctgctgcgcgcctacgccggggtacgccccctggtggcggtggacggcgac
gagagtggccgcaacatcagccgcggcatagtgctgctggatcacagcgatcgcgacggc
ctcaagggcttcaacaccatcaccggcggcaagctgatgacctaccgcctgatggcggaa
tgggccaccgatctcgtcgccaacaagctgggcaattcccggccctgccgcaccgccgaa
ctgagcctgcccggctcacgggatccggagaaggtctcggcccccggtctctctgtgccc
gccgaaggctcggcccagtaccgccacggcgagcgggtcatcgccttctttcgtgacaat
cccaaggccaacgccctcatctgcgagtgcgagatggtgaccgcaggggaaatcgaatac
gccctgcgcgagctcgacgtggacaacctggtggatctgcgccgtcgcacccgtctgggg
atggggccctgccagggggagctgtgtgcctatcgcgccgccggtctgatgcaggagtat
ggcaaggccgacggccgtgaggcctgcgtcatgctgcgccagtttctggaggagcgttac
aagggcacccgtccggtgctctggggcgatgccctgcgcgaagcggaatttacctactgg
atctacgaatggctgttcggccttggcgagtggacggccccccacctggtggccgagccg
cccttcccgctcgatgccagcaccgcagccaaccccaccaaggagtgcagccatgaaatt
tga

DBGET integrated database retrieval system