KEGG   Aeromonas media: B224_2809Help
Entry
B224_2809         CDS       T03075                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amed  Aeromonas media
Brite
KEGG Orthology (KO) [BR:amed00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B224_2809
Enzymes [BR:amed01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B224_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Glutaredoxin FMN_bind NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AHX61297
UniProt: A0A023RJ60
LinkDB All DBs
Position
2211237..2212823
Genome map
AA seq 528 aa AA seqDB search
MLDTNLKQQLNGYLQYIVNPIEISVSGNDSDKSAELLALANEIAEMSPKISMTDGTAARK
PSMSVAPQGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADPAVLEQVRNLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRTSLEEIVAKLDTGAAERKAAELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYDVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNAAPEAAAAKADAVTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaacctcaaacaacaactcaacggttacttgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaatgacagcgacaaatccgcagagctcctggcattggcc
aacgagatagcagagatgtcccccaagatttccatgaccgatggcactgccgcccgcaag
ccttccatgagcgtggcgccacaaggccaggcaccgcgcgtgcattttgccggcatcccc
atgggtcatgaatttacctccctggtgctcgccctgctgcaaagcggcggccacccctcc
aaggccgatccggcagtgttggagcaggtcaggaacctcaagggcgagttccacttcgag
acctatatctccctctcctgccacaactgcccggacgtggtacaggccctgaacctgatg
gccaccctgaaccccggcatcacccacaccatgatcgacggtgccctgttccaggacgag
gtgaacgagcgccagatcatggcggtcccgaacgtctacctgaacggccagccgttcagc
cagggtcgcacctccctggaagagatcgtcgccaagctcgatactggcgcggcagagcgc
aaggccgcagagctgagcgaaaaggccccctacgacgtgctggtagtgggcggtggcccg
gctggcgccgcagcggccatctatgccgcccgtaaaggcattcgcaccgccatcgtcgcc
gaacgcttcggtggccaggtgatggacaccgtcggcatcgagaacttcatctccgtgccc
tacaccgagggccccaagctggccgccagcctggagcagcacgtcaagcagtacgacgtg
gaagtgatcaccgagcagcgtgccgccgccatcagcaaggatggctatgtgaacgtggat
ctcgcctccggcgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgcgacctgaacgtgccgggcgagctcgagtaccgcaccaagggcgtggcctactgcccg
cactgtgacggccccttcttcaagggcaagcgggtcgcggtgatcgggggcggcaactcc
ggtatcgaggcggccatcgatctggctggcatcgtcgagcacgtcaccgtggtggagttc
gccgataccctgcgcgccgacgaagtgctgcagaagaaggctcgctccatgggcaacatc
gacatcatcatgagcgcccgcaccaccgaagtgatcggtgacggcagcaaggtggtgggc
atggactacgaggatcgcactactggtgagatcaagcacctggcggtggccggcatcttc
gtgcagataggtctggtaccgaacaccgagttcctgaaagggagcgaggtggccctgacc
cgctttggcgagatcgagatcgacaccaagggcgccacctccctgcccggcgtctatgcc
gcaggggatgccaccactgtgccgttcaagcagatcatcatctccatgggcgccggtgcc
accgccgccctgggggccttcgattacctcatccgcaatgcggcgccggaagccgctgcc
gccaaggccgatgccgtgaccgcctga

DBGET integrated database retrieval system