KEGG   Astyanax mexicanus (Mexican tetra): 103021311Help
Entry
103021311         CDS       T05042                                 

Gene name
mgst2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00480  Glutathione metabolism
amex00980  Metabolism of xenobiotics by cytochrome P450
amex00982  Drug metabolism - cytochrome P450
amex00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103021311 (mgst2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103021311 (mgst2)
   00982 Drug metabolism - cytochrome P450
    103021311 (mgst2)
   00983 Drug metabolism - other enzymes
    103021311 (mgst2)
Enzymes [BR:amex01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103021311 (mgst2)
Transporters [BR:amex02000]
 Other Transporters
  Pores ion channels [TC:1]
   103021311 (mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 103021311
NCBI-ProteinID: XP_007229926
LinkDB All DBs
Position
24
AA seq 146 aa AA seqDB search
MSSTDQPVLLAAVSVMSAFLLGFQARRVGWSRMKHKIMPPAVNGPPEFERTFRAHQNGVE
FFPMFLVVLWASGLFCNEALAALAGLVYIVGREIYFTGYSNSSRGRLPGFYLIIVVLLTL
TVTAAGGIILSLLDKYLNIKLFSRSK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacagatcaacctgttcttctggccgcagtgtccgtgatgtcagccttcctc
ctggggttccaggccaggcgtgtcggctggtccaggatgaagcataaaattatgccccct
gcagtgaacgggcccccagagtttgagaggacttttcgggcacaccagaatggagtggag
ttttttcccatgtttctggtggtgctgtgggcatctggactgttttgtaatgaagcttta
gctgcgctggctggactggtgtatattgtgggcagagagatctattttactggctattcg
aattcatccagagggagattaccaggattttacctgatcatagttgttttgctcaccctg
actgtgacagctgctggaggcatcattctctcactcctggataaatatctcaacatcaaa
ttgttctccaggtctaaataa

DBGET integrated database retrieval system