KEGG   Astyanax mexicanus (Mexican tetra): 103021407
Entry
103021407         CDS       T05042                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta-like isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04217  Necroptosis
amex04621  NOD-like receptor signaling pathway
amex04625  C-type lectin receptor signaling pathway
amex05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103021407
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103021407
   04625 C-type lectin receptor signaling pathway
    103021407
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103021407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103021407
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103021407
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 MAGE Sigma54_activ_2
Other DBs
NCBI-GeneID: 103021407
NCBI-ProteinID: XP_007249195
Ensembl: ENSAMXG00000013030
LinkDB
Position
13
AA seq 830 aa
MSQWERLKQLDSVCLQKVDELYSRDDFPMDVRDYLAQWIEDQDWEGASRDSSRAVVLFQI
LLENLDNQYSRFTQERCFLMQRNFKRFKQNFQRFQEDPCTLAEIISWFLRSEKRILEDAE
LAQEVQMLQVQPNPMETESQRYVEKNVREFKNKVQVMEHSLRCLEEQQDEFDFKYQTHRM
DGTTDGAERNEQLKVLQGMLNRLNNSRMIFLSELSAMLDSAESLLAKLTEDLDQWKRRQQ
ISCIGAPEDTNLDPLEKWFTQVGDGMFQLRKFLLKLEELLDKLSYDEDPIKDQKPILQER
VDTLLTTLIKSAFIVETQPSMPQGRGPLVLRTNVQFSVKARLLFKVPELNHAMKVNVSIG
NDAPNVKGYRRFNVLGTSSKALNMSESMNGGMVADFRHLTLKEKKVGAGGKGINDLSLSV
TEELHTIHFETQFEMHGLSVSLETTSLPVVVISNSSQQQSAWASVLWFNMLCLDPNNLLF
FASSPVASWSQLGQMLSWQFIACAERGLNEDQLETLAQKLFGKQQSYDNCKISWTRFSKE
NISGQSFTHWVWLDGILNLVKVYLSQLWNDGSILGFVSKGKEKVLLKKKQGGTFLLRFSE
SCKDGGITFSWVEYTNDGEPNVRSVQPFTSVDLKQIPLAEILRNFQIMEAENAPVYPLQF
LYPNTPKDQAFGKYYNEMTGEQSPYFKYIKTKLVFVSKENGCTSVAGEPVPDLCTQPNDR
CSEEDIMLRGPESSPMLSNCTSNPESPNEFLENSLNGHLEFPDLLNLPPDNYDGLKNSAN
GVSESFLNIISESFSPVSDLTTFQEFLNDPHLLEGIGTFSEFSEGMPLTP
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgtctcagtgggagcgcttgaagcagctcgactcggtgtgtttacagaaggtggatgag
ttgtacagtcgagatgattttcccatggatgtaagagactacctagctcagtggatcgag
gaccaagactgggaaggtgcttcacgcgacagttcccgagcagtggttctgttccagatc
ttgctggagaatctggataatcaatatagtcgtttcacacaggagcggtgcttcctcatg
cagcgcaacttcaaacgctttaagcagaactttcagagatttcaagaagatccatgtact
ttggctgaaataatcagctggttcctgaggagtgagaaacggatcctagaagatgcagag
ctagcacaggaagttcagatgttgcaggttcagccaaaccctatggagacagagagtcag
agatacgtagagaagaatgtcagagagtttaagaacaaagttcaggtaatggagcactca
ttgagatgcctggaggaacaacaagatgagtttgactttaaatatcagacgcacagaatg
gatggtacaactgatggagctgaaagaaacgagcagttaaaggtgctgcaaggaatgctt
aacaggctcaataactccagaatgatatttctcagtgagttgtcagcaatgttggattct
gctgaatcacttctagccaagcttacagaggatctagatcagtggaagagaagacagcag
atatcatgtattggtgctccagaagacacaaatctggacccactggagaaatggttcaca
caggtaggggatggaatgttccagctacgcaagttcctgctgaagttggaggagctactg
gacaagttgagctatgatgaggaccctatcaaagaccagaaacccatcctgcaggaacgt
gtggatactctattaaccaccctgattaagagtgctttcatcgtggaaacccagccatct
atgccgcagggtcgaggccctcttgtgctgcgtacaaatgttcagttctcagtcaaagcc
agattgctgtttaaggtgcctgagctcaaccatgccatgaaagtgaatgtgtccattggc
aatgatgctcctaatgtaaaagggtatcgcaggttcaatgttcttggaacatcaagtaaa
gctctgaatatgtctgagagcatgaatgggggcatggttgcagacttcagacatttgact
ctgaaagaaaagaaggttggagcaggtggaaaaggaattaatgatctgtctttgagtgtg
acagaggagctccacaccatacactttgagacacagtttgaaatgcatggcctgtcagtc
tctttggagaccacctctctccctgtggtagtgatctctaactccagccagcagcagagt
gcctgggcttctgttctgtggttcaacatgctctgccttgaccccaacaacctgctgttt
tttgcgagctctcctgtagcatcttggagtcagcttggtcagatgctgagctggcagttt
atagcatgtgctgagcgtggtctgaatgaagaccagcttgagactctggctcaaaaactc
tttggtaaacaacagagttatgacaattgtaaaatatcctggaccagatttagcaaggag
aacatcagtggtcaaagcttcacgcactgggtctggctggatggaattctaaacttggtc
aaagtttacctttcacagttgtggaatgacgggtctatcctgggatttgtaagtaagggg
aaggaaaaggtgttgttgaagaagaagcagggtggcactttcctcctacgcttcagtgag
agctgtaaagatggtggaatcacattcagctgggtggagtacactaatgatggtgaaccc
aacgtgcgatcagtgcagccgttcaccagtgtagacctgaagcagattccattggcagag
atcctgcgcaactttcagatcatggaagcagagaatgctccagtctacccacttcagttc
ctctacccgaacacccccaaagaccaggcgtttggcaaatactacaatgagatgactgga
gagcaaagtccatactttaaatacattaaaaccaagctggtcttcgtgtcaaaagagaat
gggtgtacaagtgtggctggggagccagtgcctgacctgtgcacgcagcccaatgaccgc
tgctctgaagaagacatcatgctgcgagggccagagagctcacccatgctttccaactgt
acgagcaaccctgagtcacccaacgaatttttggaaaactctttaaacggccaccttgag
ttcccagatttacttaatttacctccagataattatgatggcctaaagaattcagccaat
ggtgtttccgaatcctttctgaacatcatttcagagtcgttttccccagtttctgatctt
actacatttcaggagtttctgaatgatccacatctcctggaaggaataggcactttttct
gagttttctgagggaatgcctttaactccctga

DBGET integrated database retrieval system