KEGG   Astyanax mexicanus (Mexican tetra): 103021870
Entry
103021870         CDS       T05042                                 

Gene name
gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04110  Cell cycle
amex04150  mTOR signaling pathway
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04510  Focal adhesion
amex04910  Insulin signaling pathway
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103021870 (gsk3b)
   04310 Wnt signaling pathway
    103021870 (gsk3b)
   04340 Hedgehog signaling pathway
    103021870 (gsk3b)
   04150 mTOR signaling pathway
    103021870 (gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103021870 (gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103021870 (gsk3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103021870 (gsk3b)
   04916 Melanogenesis
    103021870 (gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103021870 (gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103021870 (gsk3b)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     103021870 (gsk3b)
Protein kinases [BR:amex01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   103021870 (gsk3b)
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103021870 (gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 103021870
NCBI-ProteinID: XP_007233135
Ensembl: ENSAMXG00000008836
LinkDB
Position
19
AA seq 425 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGGKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGEMVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNIKLPNGREK
PSLFNFTTQELSSNPSLASILIPAHARNQAGASTPSNASSTTDGNNGDRGQTTTAASASA
SNTST
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtctggacggcctagaaccacctccttcgcagagagctgcaaaccagtgccgcagcca
tccgccttcggcagcatgaaagtcagcagagataaagatggcggtaaggtgaccacagtg
gtggcgaccccaggccagggtcctgacaggccgcaggaggtcagctacacagacactaag
gtcatcggcaacggctcgttcggcgtggtctaccaagctaaactctgcgactcaggagaa
atggtggccatcaagaaagtcctgcaggacaagagatttaagaatcgtgaacttcagatc
atgagaaagctggatcactgcaacatcgtccgcctccgatacttcttctactccagtgga
gataagaaggacgaggtgtatctgaacttggtgttggactatgttcctgagaccgtgtac
agagtagccagacactacagccgagccaaacagaccctacctatggtttatgtgaagttg
tatatgtaccagctcttcaggagtctggcctacatccattcgtttggaatctgccatcgg
gacatcaaaccacagaacctgctgctggacccagagacagccgtgctcaagctctgcgac
ttcggaagtgctaagcagttggttcgaggtgagcccaatgtgtcctacatctgctcacgg
tactacagagcccctgaactcatcttcggagccactgactacacctccagcatagacgtg
tggtcggctggctgtgtgctggctgaactgttgctagggcaaccaattttccccggcgac
agcggagtggatcagctggtggagatcatcaaggttctgggaacacccacacgtgagcag
attcgtgagatgaacccaaactacacagagttcaagtttccccagattaaggcccaccca
tggactaaggtgagtcaacaggtgttccggccacgcacaccacctgaagccattgccctg
tgctctaggctgctggagtacacacccaccgctcgcctcactcctctcgaggcctgtgcg
cactcctttttcgatgaactgcgggaccccaacatcaaacttcccaacggacgagagaaa
ccctcgctatttaacttcaccactcaagaattgtccagtaacccatccctggccagcatc
ttgattcctgctcatgcacgtaatcaggctggagcctccaccccctccaatgcctcctcc
actacagatggcaacaatggggaccgcggtcagaccaccactgcagcctctgcctcggcc
tccaacacctctacctga

KEGG   Astyanax mexicanus (Mexican tetra): 103043574
Entry
103043574         CDS       T05042                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04110  Cell cycle
amex04150  mTOR signaling pathway
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04510  Focal adhesion
amex04910  Insulin signaling pathway
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103043574
   04310 Wnt signaling pathway
    103043574
   04340 Hedgehog signaling pathway
    103043574
   04150 mTOR signaling pathway
    103043574
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103043574
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103043574
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103043574
   04916 Melanogenesis
    103043574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103043574
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103043574
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     103043574
Protein kinases [BR:amex01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   103043574
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103043574
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 103043574
NCBI-ProteinID: XP_022530488
LinkDB
Position
12
AA seq 420 aa
MSGRPRTTSFAESKPVSQPLAFGNVKVSRDKDGSKVTTVGATPGQGPDRPQEVSYMDTKV
IGNGSFGVVYQAKLCDTGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGD
KKDEVYLNLVLDYVPETVYRVSRHYSRAKQILPMLYVKLYMYQLFRSLAYIHSFGICHRD
IKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVW
SAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPW
TKVFRPKTPPEAIALCSRLLEYTPTARFTPLEACAHAFFDELRVPTLKLPNGRERPPLFN
FTTQELSSNPSLASILIPAHARNQAGASPPSNASSTADASSGERGPTTNAASASAPNPST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcaggtcggccaagaaccacctcctttgcggagagcaaacccgtgtcgcagccttta
gcgtttggcaacgtcaaagtgagccgggataaagatggcagtaaggtgacgacggtggga
gcgaccccagggcagggtccagacaggcctcaggaggtcagttacatggacacgaaggtc
attggaaatggctcttttggtgtggtctaccaggctaagctctgcgacactggagagctg
gtcgccattaagaaggtcctgcaggacaagaggttcaagaaccgtgagctacagatcatg
aggaagctggaccattgcaacattgttcgcctgcgttatttcttctactccagtggggat
aagaaggacgaagtgtacctgaacttggtgctggactacgtcccagagactgtctaccga
gtttccaggcattacagccgagccaagcagatccttcccatgctttatgtaaagctgtat
atgtaccagttgttccgcagtttggcatacatccactcctttgggatctgccatcgggac
atcaagccccagaacctactgctggaccctgagactgctgtgctcaaattatgtgatttt
ggcagcgctaagcagctggtccgtggtgagcccaatgtctcctacatctgctctcgctac
taccgagcccctgagctcatctttggagccacagactacacctctagcatagatgtgtgg
tcagctggctgtgtgctagcggagcttcttctggggcagcccatcttccctggggacagt
ggggttgaccagctagttgaaatcatcaaggtcctggggacccccactcgtgagcagatc
cgtgagatgaaccccaactacacggaattcaagtttcctcaaattaaagcccacccgtgg
actaaggtgttcagaccgaagacccctcctgaggcgattgctctgtgttctcggttgctg
gagtatacacccacagcacgctttactcctctggaggcctgcgcccatgccttctttgac
gagctacgcgtaccaaccctcaaactccccaatggccgagagagaccaccactcttcaac
ttcaccacccaggagttgtccagtaacccatcgctggcatccatacttatccctgcacat
gcccgcaatcaggccggagcctcccctccctcaaacgcctcatctacggcagatgccagc
agcggcgaacgcggcccaaccaccaacgctgcctccgcttctgccccaaacccctcgacc
tga

DBGET integrated database retrieval system