KEGG   Astyanax mexicanus (Mexican tetra): 103022388Help
Entry
103022388         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00500  Starch and sucrose metabolism
amex01100  Metabolic pathways
amex04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103022388
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103022388
Enzymes [BR:amex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103022388
Glycosyltransferases [BR:amex01003]
 Polysaccharide
  Storage polysaccharide
   103022388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 103022388
NCBI-ProteinID: XP_007256341
Ensembl: ENSAMXG00000000542
UniProt: W5JYZ1
LinkDB All DBs
Position
2
AA seq 742 aa AA seqDB search
MPLARSVSVTSLSGLDEWDEDFDLDDAVLFEIAWEVANKVGGIYTVIQTKARLTCEEWGE
NYFLVGPYMESNVRTQVELIEPTNPVLRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVG
FTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEDPPHILAHFH
EWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCLERAAARCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KSRIQEFIRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADLFLEALARLNYLLRVNHSET
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPEVSKML
DKEDFTMMKRAIFATQRQCLPPICTHNMLEDSSDPILTCIRRIGLFNSSQDRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSSYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRY
LGRYYVSARHMALSKAFPDTYVYEPHDPTSTSGFRYPRPASVPPSPAHSLHSSPHHSEAE
DEDERYDEELEAEKDRVNIRXPFSLPLKNKSLPVDAVNAVDAVNAVDAVNSVEAVNSVDA
VNVVDAVNSVDAVDAVDLPEKN
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgccgttggcacggagtgtctcagtcacctccctctcgggcctggatgagtgggacgag
gacttcgatttggacgatgccgttctcttcgaaattgcatgggaggtggctaataaagtt
ggtgggatctacacagtgattcagacgaaggcccgtctgacctgtgaagaatggggagag
aactacttcctggtggggccgtacatggagtccaatgtcaggacccaggttgagctgatt
gagcccaccaacccagtactccggaggaccattgataagatgaacagcagcggctgcaag
gtgtactttggacgctggctgattgagggatctccatatgtggtcctgcttgacgtgggc
ttcactgcatggtctctggaccgctggaagagtgagctgtgggagaactgtgctattgga
gtgccttggttcgacagagaagccaatgatgctgtcctcttcggcttcctcactgcctgg
ctgctcggagagtacgcagcacagtgtgaagaccctccgcatatcttggctcattttcat
gagtggttggctggtctgggtctggttttatgcaggcagcggcagttacccgtagcaacc
attttcaccacacacgccacgctgctcggacgatacctgtgtgctgggaacgttgatttt
tacaacaaccttgcagagtttaatgtagataaggaagcgggtgacaggcagatctatcac
cggtactgtttggagcgagctgcagcacgatgtgctcacgtcttcaccactgtgtcccag
atcacagccatcgaggcagagcatctgctcaaaaggaaaccagatattgtgactcctaat
ggtctgaacgtgaaaaagttctcagctatgcacgagtttcagaacctccatgctcaaagc
aagtcacgcattcaggagttcatcagaggccacttttacggtcatttagattttaatctg
gacaagaccgtgttcctcttcattgctggacgctacgagttctctaataaaggagctgat
cttttccttgaagctctggccaggctcaactatctactgagggttaaccacagtgagacc
acggtgatagcgttcttcatcatgcctgctcgcaccaacaacttcaacgtggagacactg
aagggccaagccgtacgaaaacagctctgggatacagcccagactgtgaaagagcgcttt
ggaaagaaactctatgagtcattattagttggccagctgccagaagtgtctaagatgctg
gataaggaggatttcaccatgatgaaaagggccatctttgccacacagcgccagtgcctg
ccacccatctgcacccacaacatgctggaggacagttctgaccccatccttacctgcatc
cgccgcatcggcctctttaacagctctcaggaccgggttaaggtgattttccatccagag
tttttgtcatctacctctcctctgctgccaatggactatgaggagtttgtcagaggctgc
cacctcggggtcttcccctcttactatgagccttggggttacacacctgctgagtgcact
gtgatggggattccctctgtgtccactaacctttcagggttcggctgtttcatggaggaa
cacatagctgacccatcttcttatggaatctatattctagaccggcggtatcgtagcgtg
gacgagtcgtgtaaccagctaacctccttcctcttccagttctgtcagcagagccgcaga
cagcgcatcatccagaggaaccgtacagagcgtctcagtgacctgctggactggagatac
ctgggacggtactatgtatctgctcgccatatggccctgtccaaagccttccctgacaca
tatgtgtatgagccccatgatcccacctcgacctccggcttccgttacccacggcctgcc
tcggtgcccccctcccctgctcactccctccactcatccccccatcacagtgaagctgag
gatgaggatgagcgatacgatgaggagctggaggcagagaaagaccgcgtgaacatccgc
ncaccattcagtttaccactgaagaacaagagcctgccagttgatgcagtcaatgctgtt
gatgctgtaaatgctgttgatgcagttaactcggttgaggcagttaactcagttgatgca
gttaatgtggttgatgcagttaactcagttgatgcagttgatgctgttgacctgcctgag
aagaactga

DBGET integrated database retrieval system