KEGG   Astyanax mexicanus (Mexican tetra): 103022581Help
Entry
103022581         CDS       T05042                                 

Gene name
sdha
Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00020  Citrate cycle (TCA cycle)
amex00190  Oxidative phosphorylation
amex01100  Metabolic pathways
amex01200  Carbon metabolism
Module
amex_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103022581 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103022581 (sdha)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103022581 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 103022581
NCBI-ProteinID: XP_007253128
Ensembl: ENSAMXG00000013857
LinkDB All DBs
Position
23
AA seq 662 aa AA seqDB search
MAAALAAYRVLGKRVLSYKTVPAVFPEGIRKLHFSIHGKRGEAKISDAISTQYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDG
SIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEKD
HVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQAI
TYKDGKDQVVPGLYACGEAGCASVHGANRLGANSLLDLVVFGRACALTIAENDKPGEKLS
PLKPNAGEESVANLDKIRFAKGSMRTSEIRLNMQKTMQAHAAVFRTGDVLKEGCVKMDAI
YQTLDDVKTFDRGIVWNTDLVETLELQNLMLNAVQTINAAEARKESRGAHAREDFKERVD
EYDYSKPLQGQEKKPFEQHWRKHTLSYVDPKTGKVTLEYRPVIDDSLNNEDCAAIPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgctagctgcctaccgtgtcctcgggaagagggtgctgtcgtataaaaca
gtgccagctgttttcccagaaggcatacgcaaacttcatttctccattcatggaaaaaga
ggagaagctaaaatctcagatgctatatccacacagtatccagtggtagatcatgagttt
gatgctgtggtggtgggagcaggaggtgctggattacgtgcagcatttgggctgtcagag
gctggcttcaatacagcatgcgtcaccaaactgttccccactcgctctcatactgtggct
gcacagggtggaatcaatgcagctctcggcaacatggaggaagatgactggcggtggcat
ttttatgacacggttaaaggatccgattggttgggagatcaagatgccattcactatatg
actgagcaagcccctgctgcagtggttgagctggagaacttcggtatgcccttcagtcgt
acagaggatggaaagatctaccagcgtgctttcggagggcagagtttgaagtatggaaaa
ggaggacaggctcacaggtgctgctgtgtggctgacaggacgggtcactctcttctgcac
actctctatggacggtctctgaggtacgacacaagctactttgtggagtattttgctctg
gacctgctgatggaagatggagagtgtaaaggagtcattgcactctgcatggaggatgga
tccatccaccgcatcagagccaagaacacagtaatcgccacaggtggttatggccgcaca
tatttcagctgcacctcagcccacactagcacaggagatggtaatgccatggttacacgt
gctggcctgccgtgtcaggacctggagtttgttcagttccaccccacaggtatctatgga
gctggttgcctgatcacagaaggctgtcgtggagaaggtggaattttgatcaacagtgaa
ggtgaacggtttatggaacgctacgctccaaatgctaaagacttggcctccagggatgtg
gtgtcgcgctccatgactattgaaattcgcgagggaagaggtgtagggccagagaaggac
catgtttatctgcagctccaccaccttcctcctcagcagctggctacccgcctgcccgga
atctcagaaactgctatgatatttgctggggtggatgtcaccaaagagcctatccctgtc
ttgcccacagtccactacaacatgggaggcattcccaccaactacaagggacaggctatt
acttacaaagatggtaaagaccaggtagtgccagggttatatgcatgtggagaagctggc
tgtgcctctgtacatggtgccaatcgcctgggagccaactctttgctggatctggttgtg
tttggtcgtgcctgtgccctgaccattgctgagaatgataagccaggagagaagctttca
cccctgaaaccaaacgcaggagaggagtcagttgctaatttggacaaaatccgctttgct
aaaggcagtatgaggacctctgagattaggctcaatatgcagaagaccatgcaggcccat
gctgctgtatttcgtactggagatgttctaaaagagggatgtgtcaaaatggatgccatc
tatcagacattggatgacgtcaaaacatttgacagaggtattgtttggaacactgacctg
gtggagactttagagctccagaacctgatgctcaatgctgtgcagactatcaacgcagct
gaggcccgcaaagaaagcaggggggctcatgcccgtgaggatttcaaggaacgtgtggat
gagtatgattactccaagcccctacagggacaagagaagaagccttttgagcagcactgg
aggaagcacacactctcttatgtagatcctaaaacaggaaaggtcactctggaatacagg
cctgtgattgatgactctctgaacaatgaagactgtgctgctattcctcctgccatccgt
tcctattaa

DBGET integrated database retrieval system