KEGG   Astyanax mexicanus (Mexican tetra): 103023100Help
Entry
103023100         CDS       T05042                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00512  Mucin type O-glycan biosynthesis
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103023100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amex01003]
    103023100
Enzymes [BR:amex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103023100
Glycosyltransferases [BR:amex01003]
 O-Glycan biosynthesis
  Mucin-type
   103023100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103023100
NCBI-ProteinID: XP_007234225
Ensembl: ENSAMXG00000001673
UniProt: W5K295
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQLGRASDQRLRSRNGKVTNLDR
QSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSRETDGKYEEYGYN
AQLSDRISLDRNIPDYRPKKCKLLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHTPA
HLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAPV
VGFFDAHVEFNTAWAEPILARVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLWC
MYIIPPQDWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMRV
WQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIPM
NNPGVDFGDVSERVALRNRLKCRSFRWYLEHVYPEMRIYNDTITYGEVRNSKASGYCLDQ
GSEDDNRAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKKC
DAVSRSSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKH
PKH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaatcaagaccctgctgaccgtcaacatcctggtgttcgttggg
attatactgttctcggtgtactgccggatacaggaccgttctgaggaactggtgcagctc
ggcagggcgtctgaccagcggctgcggagcaggaatggcaaagtgacgaacttggaccgg
cagtccatcctccagaggctggaacgtctggaggacgtggtctacaaccagctgaacggt
ctggctaagccgatgggtctggtggagggtcccggtgggctgggtcagggcggagctgcg
gcgacgctgggggaggacagtcgggagacggatgggaaatacgaggagtatggatacaac
gcccagctcagcgaccgcatctcactggaccggaatatcccggactacaggcccaaaaag
tgtaagttgttgacgtatcccgaagacctgccccagatttctgtggtttttatcttcgtg
aatgaagccctgtccgtcatcctgcggtccgtccacagcgtggtcaaccacacccccgcc
cacctgctgaaggagatcatactggtggacgacaacagcgacagtgtggagctgaagttt
aatctggatcagtacgtgaataagcgatatcccggcctggtgaagatcgtcaggaactcg
aagcgggagggattgatccgggcgaggattcacggctggaacgccgctacggcgcctgtg
gtgggattcttcgacgctcatgttgagtttaacacggcctgggccgaacccatcctggcc
cgagtaaaggaggatcacacgaggatcatcctcccagccatagacaacatcaaatacaac
accttcgaggtgcagcagtacgctaacgccgcccacggctacaactggggcctgtggtgc
atgtacatcatccctcctcaggactggctggacaagggtgacgagaccgcccccatcaga
actccagcgatgattggctgctcgtttgtggtggaccgggagtactttggagaaattggg
cttctggatccaggcatggaagtttatggcggggaaaatattgaacttggaatgagggtg
tggcagtgtgggggcagtatggaggtgttgccttgcgctcgagtcgcgcacatcgaacgt
acgaagaaaccgtacaacaacgacatcgactactacgccaagcgcaacgccctgagagcc
gcagaggtctggatggacgagttcaagtcacatgtctacatggcctggaacatcccaatg
aacaatccaggggtggattttggagatgtttcggagcgggtggctctcaggaacaggctg
aagtgtagaagtttccgctggtatctggaacacgtttaccccgagatgaggatctacaac
gacaccatcacctacggagaggtgcggaacagtaaagccagtggttattgcctggatcag
ggttcagaggatgataacagagcaatactctacccctgccacggcatgtcatcccagtta
gccaggtattccacagagggtctcctgcagctcgggcccctggggtccaccaccttcctc
cctgataccaaatgcctggtggatgacggccggggccgcacacccagcctgaagaaatgt
gacgctgtgtctcgatcgtctcagcggctgtgggatttcacacagaacggtccaatcata
agtcgggatacggggcgctgtctggaggtggaaatgtccaaagacgcgaactttggtctg
cggctggtggtgcagcgatgctccggccagaagtggatgattcggaactggatcaaacac
cccaaacactga

DBGET integrated database retrieval system