KEGG   Astyanax mexicanus (Mexican tetra): 103023638Help
Entry
103023638         CDS       T05042                                 

Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
amex  Astyanax mexicanus (Mexican tetra)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ AAA_5 RsgA_GTPase TsaE RuvB_N Sigma54_activat AAA_33
Motif
Other DBs
NCBI-GeneID: 103023638
NCBI-ProteinID: XP_022525969
Ensembl: ENSAMXG00000005108 ENSAMXG00000009486
LinkDB All DBs
Position
6
AA seq 819 aa AA seqDB search
MSHSLYSKLWSGAQEELGSLLTQELPVEPLRPERDRVVFFQRLATLYVRYVQIFRQLEEA
YDQIVQPQKRILIRQVLDNVIGRVLELKNEMVEKEYSEYHYMDDVIQDMKLTPEDLEIPI
PRYFISERSKVLRDRSKILSSILEKLEVVEKPKTGAERTLSMEKAIRIIQVTERARQGRL
RAKFMREIQRDQERQKKSLNRDLGEAAAEQAAICIQKVWKGFMQRKRTKQESEEEMIFLG
MAPDHSLPQPCPASVVAEDTKNRRRIRQEEHEEDYQKSIISITNSLREVEGPDMKENMKD
QIRQWFIECHDATGSFPDFPEEEDGGSSLIFADKTPEQLMEELAAKEEEETSKRPKGKEE
NIDRRKGPGEEEEEEPGLMMLPSAFLSQLQTGQKTFTDVWKNREESKNFNQRHEAELIKE
EKRKEIEAEIRLQVDELMRQELANWKLAVDGDKGGKAKAAAKKKKASKSGKKKKKEKDLT
ADRTIESLYQELVEQGLLKPADNVKLQDYIGDYSYLGTTLRLTDIEPMPSLSDVRQVIAL
YAVLPLGSQVVHEKAPLVKAILLVGPSGVGKKMLVHAICQETGANLFDLSSANLVGKYPG
KNGLTMMLHMVFKVARLMQPSVVWIGDAEKMFYKKVPKEEKELDPKRLKKDLPKILKGMK
GEDRVLIVGTTNSPVNADLKSLCKVYTKIILIPRPDYASRYVMWKQLIQRNGGVVTSTLD
ISSLAKISDGYTQGHMVQVIRSVLTERRIQLLAKRPLVATEFVSPLARIDPVFQDEEEAL
KAWYAKTPLGKKRIKAASGTVEDEAPKKGGKNGKKKGKK
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacagtctgtacagtaagctctggagcggggctcaggaggagctgggcagcctg
ctgacccaggaactgcccgtcgagcctctccgacccgagagagaccgagtggtgttcttc
cagcggctcgcgaccctttacgttcgctacgtccagatcttcaggcagctggaggaggcg
tatgaccagatcgtccaacctcaaaagaggattctgatccgacaggttctggacaacgtt
attgggcgcgtgctggagctcaagaacgagatggtggagaaggagtactctgagtatcac
tacatggatgatgtcatacaggatatgaaactaacacctgaggatctggaaattccaatc
ccacggtatttcatcagcgagcggagcaaagtgctgcgggaccggagcaaaatactctcc
agcattctggagaagctagaagtggtagagaagcctaaaactggtgcagagcgaacgctg
agcatggagaaggccattaggatcattcaggtgacagagagggcgcggcagggtcgtctg
agggccaagttcatgcgggagatccagagggatcaggaaaggcagaagaagagtttgaac
agggacctcggagaagctgctgctgaacaggctgctatctgcatccagaaggtgtggaaa
ggttttatgcagaggaagagaacgaagcaggaaagtgaagaggagatgattttcctgggg
atggctccagaccacagcctgccccagccttgccccgcctccgtggttgctgaggacact
aaaaaccgcaggaggatcaggcaggaggagcatgaagaagactaccagaaatccatcatc
tccatcactaacagcctgcgggaggtggagggccccgacatgaaggagaacatgaaggat
cagatacggcagtggttcatcgaatgccatgatgcaacaggttcgtttcctgattttcca
gaagaagaagacggcggctcttctctcatttttgctgataaaacacctgaacagctgatg
gaggagctggcagctaaagaagaggaggaaaccagcaaaagacctaaaggaaaggaggag
aatatagacaggaggaaaggaccaggagaagaggaggaggaggaacctggactgatgatg
ctgccttctgcctttctgtcgcagctgcagactggacagaaaacctttaccgatgtttgg
aagaacagagaggagtccaagaacttcaaccagagacatgaggcagagctcatcaaagag
gagaagaggaaggagatcgaggcagaaataagacttcaggtggatgagctgatgaggcag
gagcttgctaactggaagttggctgtagacggagataaaggcgggaaggccaaagctgct
gcaaagaaaaagaaggcatcaaaaagtgggaagaagaaaaaaaaagagaaggatctcacg
gcagataggaccatcgagtcgctgtaccaagaactggtggagcaggggctgttaaaacca
gcagataatgttaaattacaggactacataggtgattatagctaccttggcaccaccctg
cggctgacagacattgagcccatgccctcattatctgacgtgcggcaagttatagctctt
tatgctgtcttacctctgggttcccaagtagtccatgagaaagcccctctggtgaaggcc
atcctcctggtgggtccgtcaggagtggggaagaagatgctggtccatgcgatctgtcag
gagacaggagccaacctttttgatctgtcctcagcaaacttggtggggaagtacccgggc
aagaacggcctgacaatgatgctccatatggtatttaaggttgccagattgatgcagccc
tcagtggtgtggatcggagatgcagaaaaaatgttttacaagaaagttccaaaagaggaa
aaagagctggatccaaagcgactgaagaaagatttaccaaaaatcctcaaaggcatgaaa
ggtgaagaccgggttctcatcgtgggaacaacaaacagccccgtcaatgctgacttaaaa
tcactgtgcaaggtttataccaagatcatcctcataccacgcccagactacgcctccaga
tacgttatgtggaagcagctgatacagcgcaatggtggagtggtgaccagcaccctggac
atcagctccctggccaagatctcagatggctacacccagggtcacatggtgcaggtgatc
cggagcgtcctgacagagcggcgcatccagctgttggctaaacggccgctggtcgcgact
gaattcgtatctcctctggccagaatcgaccccgtgttccaggatgaagaggaggctctt
aaagcctggtatgctaagactcctcttggtaagaagagaatcaaagccgcctcagggaca
gtggaggacgaagccccaaagaaaggagggaaaaatggaaagaagaaaggaaagaagtaa

DBGET integrated database retrieval system