KEGG   Astyanax mexicanus (Mexican tetra): 103024013Help
Entry
103024013         CDS       T05042                                 

Definition
(RefSeq) alpha-1A adrenergic receptor-like
  KO
K04135  adrenergic receptor alpha-1A
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04020  Calcium signaling pathway
amex04080  Neuroactive ligand-receptor interaction
amex04261  Adrenergic signaling in cardiomyocytes
amex04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103024013
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103024013
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103024013
   04270 Vascular smooth muscle contraction
    103024013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:amex04030]
    103024013
G protein-coupled receptors [BR:amex04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    103024013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 103024013
NCBI-ProteinID: XP_007247270
Ensembl: ENSAMXG00000006227
LinkDB All DBs
Position
6
AA seq 479 aa AA seqDB search
MPEHREQMVLLGENMTPGISAQNCTNCSQVLVPELNVTKAVVLGIVLAIFIVFGVMGNIL
VILSVACHRNLRTVTHYFIANLAVADLLLSSTVLPFSAIFEMLGHWVFGRAFCDVWAAMD
VLCCTASIMSLCAISVDRYIGVSYPLRYPTIVTERRALLALMGVWALSITISVGPLFGWK
EPAPEDETVCKITEEPGYAIFSAVGSFYLPLVVILVMYCRVYVVARRETRGLRKGQKTEK
SDHAEAVTLRIHRGNTSASEDEALRSRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLP
FFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVLGVHCLR
RTPTPTHHLYQGHAAGHGQSQLLSLNLESRPYPSRLSHSSSMALSRTPSSRDGREWQAPS
RASSVGVNAGAKVAGVCSKNLLRTCCCIGAEQTQTQPPGGSLPIIKIHQLSLCENGDAV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacatcgtgaacagatggttcttcttggagagaacatgaccccagggatttct
gcccaaaactgcaccaactgcagccaagtcctcgtgccagagttgaacgtcacgaaagct
gttgttttgggcatcgtcctggccatcttcatcgtgtttggggtaatgggaaacatcctg
gtcattctgtctgtagcttgtcaccgcaatctgagaactgtcacacattatttcatcgca
aacctggcagtggctgaccttctcttgagctccaccgtgcttcctttctctgctatcttt
gaaatgttgggccactgggtctttggcagggccttttgcgatgtttgggcagccatggac
gtcctgtgctgcacagcatccattatgagcttgtgtgcgatttctgtagaccgttacatt
ggggtcagttatcctctacgctatccaactattgtgacagaacgcagagcattgctggca
ctaatgggagtttgggctctgtccatcactatttcagtcgggccactctttggctggaag
gagccggcgcctgaggatgagactgtctgcaaaatcacagaggagcctggttatgccatc
ttctcagcggtgggctccttctatcttcccctggtggtgatcctggttatgtattgccgc
gtgtacgtcgtggcccgcagggagacacgaggcctcagaaaggggcagaagactgaaaag
tctgatcatgcggaagcggtgaccttacggatacaccgtggtaacacttcagcttcagag
gacgaggctttgaggagccgaactcactttgccctccgactgctcaagttctcaagagag
aaaaaggctgccaagactctgggcatcgtggttgggtgttttgtcctctgctggctaccg
ttctttctggtgttgcccattggctccatcttcccagcctacagaccctcagacacagtc
ttcaagatcaccttctggcttggctacttcaacagctgcatcaaccccatcatctacccc
tgctccagccaggagttcaagaaagccttcctgagcgtgctgggcgtgcactgcctgcgc
cgcacccccacgcccacccaccacctctaccaaggccacgctgccggccacggccagtcg
cagctcctctccttgaacctggagagccgcccctacccgtcccgcctcagtcactcctcc
tccatggccctgtcccgcacaccctcgtcccgggacggccgggagtggcaggcaccgtcc
cgggcctcctcagtgggggtgaatgccggggctaaagtggctggcgtgtgcagtaaaaac
ctgttgaggacgtgctgctgcataggagcggaacagactcagactcagcctcccggcggc
tctctccccatcattaagatccatcagctctctctgtgtgagaacggggacgcagtgtag

DBGET integrated database retrieval system