KEGG   Astyanax mexicanus (Mexican tetra): 103024963Help
Entry
103024963         CDS       T05042                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04020  Calcium signaling pathway
amex04114  Oocyte meiosis
amex04140  Autophagy - animal
amex04261  Adrenergic signaling in cardiomyocytes
amex04270  Vascular smooth muscle contraction
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04371  Apelin signaling pathway
amex04530  Tight junction
amex04540  Gap junction
amex04910  Insulin signaling pathway
amex04912  GnRH signaling pathway
amex04914  Progesterone-mediated oocyte maturation
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103024963
   04310 Wnt signaling pathway
    103024963
   04340 Hedgehog signaling pathway
    103024963
   04371 Apelin signaling pathway
    103024963
   04020 Calcium signaling pathway
    103024963
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103024963
  09143 Cell growth and death
   04114 Oocyte meiosis
    103024963
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103024963
   04540 Gap junction
    103024963
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103024963
   04912 GnRH signaling pathway
    103024963
   04914 Progesterone-mediated oocyte maturation
    103024963
   04916 Melanogenesis
    103024963
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103024963
   04270 Vascular smooth muscle contraction
    103024963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103024963
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amex03019]
    103024963
   03036 Chromosome and associated proteins [BR:amex03036]
    103024963
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103024963
Protein kinases [BR:amex01001]
 Serine/threonine kinases: AGC group
  PKA family
   103024963
Messenger RNA biogenesis [BR:amex03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103024963
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103024963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase HrpJ
Motif
Other DBs
NCBI-GeneID: 103024963
NCBI-ProteinID: XP_022523764
LinkDB All DBs
Position
Unknown
AA seq 419 aa AA seqDB search
MCDRKSSRRHGSKRESRESRESRESKEPRELKEQREPKESRELREPKESRESRESRESRE
PRESSRSSDAVISGPDGPTLLVDVKEFLAKAKEDFLKKWENPAQNTASLDQFERLKTLGT
GSFGRVMLVKHKETGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFK
DNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPEN
LLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
AAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDI
KGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSFTEKCGKEFAEF
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaccgtaagagctccaggaggcatggaagcaagagggagtcgagggaatcgaga
gaatcgagagaatcaaaggaaccgagagagctaaaggaacagagagagccaaaagaatca
cgggagttgagagagccaaaagaatcgcgggagtcgagagagtcaagggagtcgcgggag
ccaagagagtcgtctcggtcgagtgatgcagtgatatcaggaccggatggtcctacactg
ctggtggacgtgaaggagtttcttgctaaagccaaagaagatttcctcaagaaatgggag
aatccagcacagaacactgcgtctctggaccagttcgagaggctgaagacactgggcaca
ggctccttcggtcgagtcatgctagtcaagcacaaagaaacgggccagcactttgctatg
aagattctcgacaaacagaaagtggttaagctgaaacagatagaacacacactgaatgag
aaacgcattctgcaagcggtcagcttcccttttctcgtacggttggagcactccttcaag
gacaattctaatctgtatatggtaatggagtatgttcctggaggggagatgttttctcac
ttgaggagaatcggcagattcagtgagcctcacgctcgcttctatgctgcccagatagtt
ctgacctttgaataccttcactcgcttgacctcatctaccgagatctgaagcctgagaac
ctgctgatagatcagcagggctatatacaggtaacagattttggctttgccaagcgtgtc
aagggccggacctggacgctgtgcggcactcccgagtacctggccccagaaatcatcctc
agtaaaggctataataaagcagtggactggtgggcgctgggggtactgatttatgagatg
gctgctggttacccccccttcttcgccgatcagcccattcaaatctacgagaagattgtc
tcaggcaaggtgcgcttcccctcccacttcagctcagacctgaaggacctgctgagaaat
ctgctgcaggtggacctgactaaacgcttcggcaacctcaagaacggcgtcagtgacatc
aagggccacaagtggtttgccaccaccgactggatcgccatctatcagaggaaggtggaa
gcccccttcatccccaagtgcaaaggtcccggggacaccagcaacttcgacgactacgag
gaagaggagatccgagtctcgttcacagaaaaatgcggaaaggagtttgctgagttctag

DBGET integrated database retrieval system