KEGG   Astyanax mexicanus (Mexican tetra): 103025184Help
Entry
103025184         CDS       T05042                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103025184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amex01002]
    103025184
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    103025184
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103025184
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103025184
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103025184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 103025184
NCBI-ProteinID: XP_022529986
LinkDB All DBs
Position
11
AA seq 246 aa AA seqDB search
MKYIILLALFAVAFAAPIDDDDKIVGGYVCTKNGVPYQASLNVGYHFCGGSLITSQWVVS
AAHCYKSSIQVRLGEHNIDVNEGTEQFISSSKVIRHPSYSSSTLNNDIMLIKLQSAASIN
SYVRTVSLPSSCASAGTYCLVSGWGNTLSSGTSYPSTLRCLDIPILSTSSCQSSYPGQIT
SNMFCAGFLEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYTKVCNYNSWIT
STINSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatcattttactggctctgtttgccgtggcattcgccgcccccattgacgac
gatgataagatcgtcggagggtacgtgtgcacgaagaacggcgtgccctaccaggcttct
ctgaacgttggatatcatttttgtggaggctctctgatcaccagccagtgggtcgtgtct
gctgcccattgctacaagtcctctatccaggtgcgtcttggagagcacaacattgacgtc
aatgagggaactgagcagttcatcagttcttccaaggtcatcagacaccccagctacagc
agcagcaccctgaacaacgacatcatgctcatcaagctgcagtccgctgccagtatcaac
agctacgtgcgcaccgtgtccctgcccagcagctgcgcctccgccggtacctactgcctg
gtctccggatggggaaacaccctcagcagtggcacaagctacccctccactctgagatgc
ctggacatccccatcctgagcacctcctcatgccagagctcctaccctggtcagatcacc
tccaacatgttctgtgctggattcctggagggaggcaaagactcttgccagggagactct
ggcggccccgtcgtgtgcaacaatcagctgcagggtatcgtgtcctggggttacggctgc
gctcagaggaacaagcctggtgtctacaccaaggtctgcaactacaactcctggatcacc
agcaccattaacagcaactaa

DBGET integrated database retrieval system