KEGG   Astyanax mexicanus (Mexican tetra): 103025268Help
Entry
103025268         CDS       T05042                                 

Gene name
ptgs1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00590  Arachidonic acid metabolism
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103025268 (ptgs1)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103025268 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103025268
NCBI-ProteinID: XP_007243953
Ensembl: ENSAMXG00000007774
UniProt: W5KK84
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MKVSQVLLLCTFTLLQEWTLCTGEVEEENSAPAKTVNPCCYYPCQNRGVCVRYGLEGYEC
DCTRTGYYGQNCTNPEFWTRIYEFLRPGPDFTHYILTHFHWLWDIINKTFLREWLMRVVL
TVRANLIPSPPTYNSKYDYVNWETYSNNTYYTRILPPVPLDCPTPMGTKGKTELPDPKLM
VEKFMLRRKFRPDPQGTNLMFAFFAQHFTHQFFKTHNRVGLGFTKALSHGVDAGHIYGDN
LDRQLGLRLHKDGKLKYQIIKGEMYPPTVAESNVNMSYPPSVPPEQQMAIGQEVFGLLPG
LSMYATLWLREHNRVCDILKEEHPTWGDEQLFQTTRLIIIGETIRIVIEDYVQHLSGYYL
KLKFDPTLLFRAQFQYQNRISVEFNQLYHWHPLMPDSFLIDRDEISYSQFIFNTSILTDY
GVEKLVQAFSTQAAGQIGGGYNIPKVVARVAEGVIKESRELRLRPFNEYRKRFNLKPYTS
FYELTGDKEMARELEELYGDIEALEFYPALLLEKTRPGAIFGESMVEMGAPFSLKGLLGN
PICSPEYWKPSTFGGKTGFDIVNSATLERLVCLNAKWCPYVSFHVPPPGSHRREESSESR
SEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagccaagttctgctcctatgcacatttaccctgctgcaggaatggacatta
tgcacgggtgaagtagaggaagaaaactcagcaccagccaaaactgtgaatccctgttgc
tactacccctgtcagaaccgtggcgtctgtgtgaggtatgggctggaaggatatgaatgt
gattgcaccagaactgggtactatggacaaaattgcactaaccctgagttctggaccaga
atctatgagttcctgaggccaggccctgatttcacccactacatcctgacccactttcac
tggctgtgggatatcatcaataaaaccttcctgagggaatggctcatgcgcgtggtgctt
acagtgcgagccaacttaattcccagccctcccacctacaactccaaatatgactatgtg
aactgggagacctattccaacaacacctactacacccgaatcctgcccccagtgcctctg
gactgccctacacctatggggactaaagggaaaaccgagcttccagaccccaagctgatg
gtggagaagttcatgttgaggcggaaattcaggccagaccctcagggaactaatttaatg
ttcgcctttttcgctcagcatttcacccaccagttcttcaagacacacaatcgggtgggg
ctgggctttacgaaagcgctcagtcatggggtggatgctggacatatctatggagataac
cttgatcgacagctaggcctaagactccacaaagatgggaagctgaagtaccagatcata
aagggagagatgtacccccccaccgtggcagagtcaaacgtgaatatgagttaccctcca
tcagtccctccagaacagcagatggccataggccaggaggtgtttgggctgctgccaggt
ctaagcatgtacgccaccctgtggctgcgggagcacaaccgtgtctgtgacatcctgaag
gaagagcaccccacctggggagacgagcagctgtttcagaccaccagactcattattata
ggtgagactattcggattgtgatcgaagactatgtgcagcacctgagcggctactacctg
aagctaaagtttgacccgaccctgctcttccgggcgcagttccagtaccagaatcgcatc
tctgtggagttcaaccagctgtaccactggcaccctctcatgcctgacagcttcttgata
gacagagatgagatctcctactctcagttcatcttcaacacctccatcctcacagactac
ggtgtggagaaactggtccaagctttctcaacccaggcagcaggacagatcggaggtggt
tataacatccccaaagttgtggcgagagtcgctgaaggagtaattaaagaatccagagaa
cttcgtttaaggcctttcaatgagtatcgcaagagattcaacctgaaaccatatacatct
ttctacgagcttacaggtgataaagaaatggcccgcgagttggaggagctctatggagat
attgaagccttggagttctatccagctctgctgctggagaaaacccgacctggtgctata
tttggagaaagcatggtggaaatgggagcaccgttttctttgaaaggccttctgggaaat
cctatatgttcaccagagtactggaagcccagtacatttgggggaaaaacaggattcgat
atagtcaactccgcaacactggagaggctggtgtgcctcaatgctaaatggtgtccgtac
gtgtccttccacgttcctccccctggctcccatcgacgagaggagtcaagcgagtctcgt
tctgagttatag

DBGET integrated database retrieval system