KEGG   Astyanax mexicanus (Mexican tetra): 103025632Help
Entry
103025632         CDS       T05042                                 

Gene name
irs1
Definition
(RefSeq) insulin receptor substrate 1 isoform X2
  KO
K16172  insulin receptor substrate 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04068  FoxO signaling pathway
amex04140  Autophagy - animal
amex04150  mTOR signaling pathway
amex04910  Insulin signaling pathway
amex04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103025632 (irs1)
   04150 mTOR signaling pathway
    103025632 (irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103025632 (irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103025632 (irs1)
   04920 Adipocytokine signaling pathway
    103025632 (irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 103025632
NCBI-ProteinID: XP_007233587
Ensembl: ENSAMXG00000006737
LinkDB All DBs
Position
1
AA seq 1105 aa AA seqDB search
MASPSAEQGCFSDVRKVGYLRKPKSMHKRFFVLRAASSAGPSRLEYYENEKKWRHKSGAP
KRSIPLENCFNINKRADSKNKYLVALYTKDEYFAIAADNELEQDTWYQALVDLHNRGKVH
ESAGSNKTGIGEDNYCEITPGPAFKEVWQVILKPKGLGQTKNLTGVYRLCLTNKTLGFVK
LNSDAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEA
MKAMSEEFRPRSKSQSSSNCSNPISVPVRTRHHHNNPPPSQVGLGRRSRAESVTAISPAG
ASKHSQSFRVRASSDGEGTMSRPASVDGSPSSPCTARPHSQRHRGGSRLHPPLNHSRSIP
MPSSRCSPSAVSPVSLSSSSTSGHGSTSDCLFPRRSSASISGSPSDGGFISSDEYGSSPC
DFRSSFRSVTPDSLGHTPPAKEEELNNYICMAKPGSLTSNGSQSRSHSRGTPNRLDEPEL
EKCFRKRTHSSGTSPPTLSHQKTTLQSSAASLDEYTVMTPAYSHSRSASSSSSSSTYRSS
FMPTRLYPEESLEMQPAEGSNGSSHKDEGYMPMSPGVAPSVVMGKTGDYMPMSPKSVSAP
QQIVNPRQHSRVDTNGYMMMSPSGSCSPDVSSNYRKIWSNGVNPKLSVESTEEKVSCGDY
INMSPASCSTIGTPPDCYFNPVDEPSRPAYAYFSLPRSFKHANRKQDQSPLRVSLGTSRL
ACTESSSSSASSDSLGGQCSSHPPAVRPKRSEVSSRLARPTRLSLDANKASTLPRMRESP
FPPEPKSPGEYVNIEFNDKAFSASLASLFSPVFTGNGNDIQSVQSSTDYMNIQLGSTSSL
SSSRIPSSCSDYAVIAPSETSASQPLPCESICERDYISMQLAVSCSGYPNSQMMLMHSSL
PDSDAPHCSDSPNDGILTLSAGPGRPGLGPLTGLSAFTRINSIPARDQGAKVIRADPQGR
RRHSSETFASTTTKGAVGTTAGIQSEDVKRHSSASFENVWLKPVEAAVTTTTTTFASSSP
AASTSSGPRETSTAATLAQQKNNGLNYIDLDLAQNRLQAVPDWSLFQARQAELDATGGAE
ELSAYASISFQKADETRGNLTHREE
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtccctctgcagagcagggatgtttctcagacgtgagaaaggtgggttattta
aggaaaccgaaaagcatgcacaaaaggttttttgtcctgcgggcggcgagctctgctgga
ccttcccggctggagtactacgagaacgagaagaaatggagacacaagtctggggctcct
aaaaggtcaattccacttgagaactgcttcaacataaacaaaagagcggattccaaaaac
aaataccttgtagcgctctacaccaaggacgagtacttcgcaatcgctgcagacaacgag
ctggagcaggacacatggtatcaggcccttgtagaccttcacaacagaggtaaggtccat
gaaagcgccgggagcaacaaaaccggaattggggaggataattattgtgaaattacaccg
ggtcctgccttcaaagaagtgtggcaggttatattgaaaccaaagggacttgggcagaca
aaaaacctgactggggtttacagattatgtctaaccaacaagactttgggctttgtaaaa
ctaaattcagatgcagcagcagtggtgcttcagctaatgaacattcgaagatgtggccac
tctgaaaatttcttctttatagaagttggccggtctgcagtgactgggccaggtgagttc
tggatgcaggtggacgactctgttgtggctcagaacatgcacgaaaccattttagaagca
atgaaagcaatgagtgaagagtttcgaccacgcagcaaaagccagtcctcgtcaaactgc
tccaaccccatttctgtgccagtcaggacaaggcatcatcacaacaaccctcccccgagc
caggtcgggctgggaaggcgctccagggctgaaagtgtgaccgccatctctcctgcaggc
gcaagcaaacacagccagtcattcagagtgagagcatccagtgatggagagggtaccatg
tcaagacctgcatctgtagatgggagcccgagtagcccatgcaccgcaagacctcattct
cagaggcatagaggtggatccaggttgcatccaccattaaaccatagcagatccattccc
atgccctcatcacgatgctccccatcagctgtcagcccagtcagcctgtcttccagcagc
accagtggacatgggtctacctccgactgccttttccccagacgctccagtgcctcgatc
tcaggatcacccagcgacgggggcttcatctcttctgacgaatatggttccagtccgtgc
gattttcggagctcgtttcgcagcgtaacccctgattcacttggacatacacctccagcc
aaggaggaggagctgaacaactatatctgcatggccaaacctggttcactgactagcaat
gggagccagtcgaggagtcattccagaggtacaccaaatcgcctggatgaaccagagctg
gagaaatgtttcagaaaaagaactcattcttctggcacatcacccccaacattaagccac
cagaaaacaactttgcaatcatctgctgcttcgctggacgaatacacagtcatgactcct
gcttattcacatagccgatctgcatcctcctcctcgtcatcttcaacatataggagctct
ttcatgcccacacgcttgtatccagaagaaagtttggaaatgcaaccagcagaaggcagc
aatgggtcaagtcacaaagatgaaggttacatgccgatgtcaccaggtgtagctccgtct
gtggtaatgggaaagactggtgactatatgcccatgagtcccaaaagcgtatcagcccca
cagcagattgtcaacccacgacagcattcgcgagtcgacacaaacggctacatgatgatg
tccccaagtggtagctgttcgccagatgtttcatcaaactacagaaagatttggagcaat
ggtgttaaccccaagctctcagttgagagcactgaggagaaagtgtcctgtggagactac
ataaacatgtctcctgctagctgctccaccatcggaactcctccggactgctacttcaat
cctgttgatgagccatccaggccagcctatgcatacttctccttgcctcgctcctttaaa
cacgccaacaggaaacaggaccagagtccgttacgggtgtcgcttggcactagtcgcttg
gcttgcacagaatcttcctcgtcttcagctagcagtgacagtctgggtgggcagtgcagt
tcacacccacctgctgtcaggcccaaaaggtcagaggtcagctctagactggcacgacca
acgaggctgtccctggatgctaacaaagccagcacacttccacgaatgcgcgaaagcccg
tttcctcctgagcctaaaagtcctggagagtatgtcaacattgaatttaacgacaaggca
ttttcagcaagcttggcttccttattttcaccagtatttactggcaatggaaatgatatc
caatctgtgcagtcatccactgactacatgaacatacaactgggttcaacaagctcgctc
tcaagctccagaataccatcgtcctgttctgactatgcagtaattgctccatcagagact
tctgcttctcagcctctgccttgtgaaagcatttgtgaacgtgactatatcagcatgcaa
ctcgccgtgtcttgttcaggctatcctaattcccagatgatgctcatgcactcttcctta
ccagactcggatgcccctcactgctcagattcacccaatgatggcatcttaaccctcagt
gcaggtcctggtaggcctggtcttggtcctctgacgggtctcagcgctttcaccagaata
aattccattcctgcccgggaccagggtgctaaagtgatccgggccgacccacaaggcagg
agacggcacagctctgagacgtttgcctccacaacgaccaaaggggcggtaggcacaaca
gcgggcattcagtctgaagatgtcaagcgccacagctctgcctcgtttgagaacgtttgg
ctaaagcctgttgaggctgctgttacaacaactactactacttttgcttcttcctctcca
gctgccagcacatcaagtggaccgagagaaacatcaacagctgccaccttggcccagcag
aaaaataatgggctgaactacatcgatctggatctggcacagaatcgactgcaggctgtt
ccggactggagcttgttccaggcccgacaggcggagctggatgcaacaggaggagcggag
gaacttagtgcctatgccagtatcagcttccagaaagcagatgagaccagaggaaacctc
actcacagagaagagtga

DBGET integrated database retrieval system