KEGG   Astyanax mexicanus (Mexican tetra): 103026237Help
Entry
103026237         CDS       T05042                                 

Gene name
tmprss3
Definition
(RefSeq) transmembrane protease serine 3
  KO
K09634  transmembrane protease serine 3 [EC:3.4.21.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103026237 (tmprss3)
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103026237 (tmprss3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Ldl_recept_a SRCR Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 103026237
NCBI-ProteinID: XP_015456711
Ensembl: ENSAMXG00000008759
LinkDB All DBs
Position
19
AA seq 569 aa AA seqDB search
MANPDGQEAEVGVPAEAGLMNGVLEAPAGGEENIATQIQAGGTEQTCPSRIEVLSVGDED
HPALDTPSTLNVNTLESHNGSLAGENSTNKPAAQTTESTECQPDALNNIQTQPSPAMPVT
KVQPFLSADLVEEKTLRGRLFARRMELLIGACASLGVILVLGIGLGVGLSCVGKFRCSSS
RCISSTAQCDGHVDCEHGEDELSCVRVSGKSSVLQVLSEGVWSTVCSEDWDPELGFSACK
QLGYSSYVRSGSLLLSNIEQEYQNSLVSINLSQPGPLQAIKIHNSTNLSRTECSSGKVIT
LKCLECGSRPQFSTRIVGGNLSLEGQFPWQVSLQFQNEHLCGGSIVATRWILTAAHCVYG
FAFPQVWTVLVGLTEQPVSVSGAKYLSVEKIIYHARYRPKGLDYDIALLKLVEPLAFNGL
VEPICLPNFGEEFEDGKMCWISGWGATEDGGEASVSLHSARVPLISAKACSQPEVYQGYI
SPGMICAGYLEGGTDSCQGDSGGPLACEDSSVWKLVGATSWGQGCAERNKPGVYTRITQA
LTWIHQQMEREETLNPSPVSSDNMNNRQD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcctgatgggcaggaggctgaagtgggcgtacccgctgaagctgggctaatg
aatggagttttggaggctccagcaggtggagaagagaacattgccacacaaatacaggct
ggagggacagaacagacgtgtccttccagaatagaggtgctctctgttggagatgaggac
catccagcccttgacacaccttccaccctcaatgttaacaccctggagagccacaatggc
agcctggcaggagaaaacagcaccaataaacctgccgctcagaccaccgaaagcacagag
tgtcagcccgatgccctcaataatatccagactcaaccctctccagcaatgcctgttacc
aaagtccagccttttctctcagctgatctggtggaggagaagactctgcgaggccgcttg
tttgcgagaaggatggagctgttaatcggcgcctgtgcttcactcggggtcatcctcgtg
ctgggtatcgggctgggagtgggtctgagctgtgtggggaagttccgctgcagctcctct
cgctgtatcagcagcactgctcagtgtgatggacatgtggactgtgagcacggcgaggat
gagcttagttgtgtgcgtgtgagtgggaagagctcggtgctgcaggtgctgagtgaggga
gtgtggagcacagtgtgttcagaggactgggatcctgaactgggattctctgcctgtaaa
cagctgggatactccagctacgtgaggtctggatctctcctgctctccaacattgaacaa
gaatatcagaatagtcttgtgtcaatcaacttgagccagccaggtccactgcaggccatc
aaaatacacaactcaaccaatctcagtaggacagagtgcagctcaggaaaggtgataact
ctgaagtgtttggagtgcggttccaggcctcagttcagcacacgtattgttgggggtaac
ctgtccctagagggtcagtttccctggcaggtgagcctgcaattccagaatgagcacctg
tgtggcggctctattgtagcaacacgctggatactgacggctgcacactgtgtttatggt
tttgcattcccccaggtgtggacggttcttgttggactgaccgagcagccggttagtgtt
agtggagcaaagtatctctctgtggagaagattatttatcacgcccgctatcggcccaaa
ggcctggattacgatattgctttgcttaaactggtggagccacttgcattcaatggcctt
gttgagcccatctgtctgcccaactttggagaagaatttgaggatgggaaaatgtgctgg
atttccggctggggggcgactgaggatgggggtgaagccagtgtgtcactgcactctgcg
agggtgccgcttatctccgccaaagcctgcagtcagcctgaagtctaccagggctacatc
tcccccggcatgatctgcgcaggatacctggagggaggaaccgactcctgccagggggac
agcggtggtccactggcctgtgaagactcctctgtgtggaagctggtgggggccacaagc
tggggtcaaggctgcgctgaaagaaacaaacctggggtgtacacacgcatcacacaggcc
ctcacctggatccaccagcaaatggagagagaagaaaccctgaatccttctcctgtcagc
tcggacaacatgaacaacaggcaggactaa

DBGET integrated database retrieval system